(data stored in ACNUC7421 zone)

EMBL: FM180568.PE705

FM180568.PE705       Location/Qualifiers
FT   CDS_pept        754864..755259
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0705"
FT                   /product="predicted minor tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0705"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08253"
FT                   /db_xref="InterPro:IPR009312"
FT                   /db_xref="InterPro:IPR035934"
FT                   /db_xref="InterPro:IPR038512"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULV1"
FT                   /protein_id="CAS08253.1"
FT                   /translation="MKHTDIRAAVLDALELHEHGATLFDGRPVVFDEEDFPAVAVYLTD
FT                   AEYTGEELDADTWRATLHIEVFLPAQVPDSELDSWMESRIYPAMTAIPALADLITTMVT
FT                   QGYEYRRDDDMALWSSADLTYSITYEM"
     atgaaacata ctgatatccg tgctgcagtg ctggatgcac tggagctgca tgaacacggg        60
     gcgacgctgt ttgatggtcg ccccgttgtt tttgacgaag aggattttcc cgcggtcgcg       120
     gtttatctga cggatgcaga gtataccggt gaagagctgg atgcagatac ctggcgggcc       180
     acactgcata ttgaggtgtt tttaccagca caggtaccgg attcggagct ggattcgtgg       240
     atggaaagcc ggatttatcc ggcgatgact gcgatcccgg cactggcaga cctgattacc       300
     acgatggtta cgcagggcta tgagtatcgt cgtgatgacg atatggcgtt atggagttct       360
     gcggatctga cttattccat tacatacgag atgtga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page