(data stored in ACNUC7421 zone)

EMBL: FM180568.PE706

FM180568.PE706       Location/Qualifiers
FT   CDS_pept        755267..756019
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0706"
FT                   /product="predicted major tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0706"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08254"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR032494"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULV2"
FT                   /protein_id="CAS08254.1"
FT                   /translation="MSTPNPLEPVKGAGTTLWVYNGQGDAYANPLSDDDWQRLAKVKDL
FT                   TPGEMTAEPYDDNYLDDEDADWTATGQGQKSAGDTSFTLAWKPGEEGQKGLIGWFESGD
FT                   VRAYKIRFPNGTVDVFRGWVSSIGKAVTAKEVITRTVKVTNVGKPSVAEERSEITPVTA
FT                   IKVTPTSGTVAKGKTTTLTVSFEPESATDKTFRAVSADPSTGTIAVKDMAITVTGVKAG
FT                   KVSIPVISGNGQFATVAEVTVTEAGAAG"
     atgtcaacac caaatcccct tgagccggta aaaggtgccg gtaccaccct gtgggtttat        60
     aacggtcagg gtgacgccta tgcaaacccg ttgtcagacg atgactggca gcgactggct       120
     aaggtgaagg atctgacgcc gggcgagatg acggcagaac cctacgatga taactacctg       180
     gatgatgaag acgcggactg gactgcgacc gggcaggggc agaagtctgc aggagatacc       240
     agttttacgc tggcctggaa accgggagaa gaaggtcaga aagggcttat aggctggttt       300
     gaaagcgggg atgtgcgggc ctataaaatc cgtttcccga acggcacggt ggatgtgttc       360
     cgtggctggg tcagcagtat cggtaaggcc gtaacggcga aggaagtgat cacccgcacg       420
     gtgaaagtga ccaacgtggg taaaccttct gtggcggaag aacgcagcga aattacgccg       480
     gtcactgcga ttaaggtgac gccgacatct ggtacggtgg caaaagggaa aacaacaacc       540
     ctgacggttt cttttgagcc ggaaagtgca accgacaaaa cgttcagagc ggtttccgcc       600
     gatccgtcaa cgggaaccat tgctgtgaaa gatatggcga tcactgtgac gggggttaag       660
     gctggaaaag tgagtatccc cgtgatttcc ggtaatggtc agtttgccac ggtagctgaa       720
     gtcaccgtta ctgaagcggg cgctgcaggg taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page