(data stored in ACNUC7421 zone)

EMBL: FM180568.PHOE

FM180568.PHOE        Location/Qualifiers
FT   CDS_pept        complement(265574..266629)
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="E2348C_0234"
FT                   /product="outer membrane phosphoporin protein E"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07782"
FT                   /db_xref="GOA:B7UJC9"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJC9"
FT                   /protein_id="CAS07782.1"
FT                   /translation="MKKSTLALVVMGIVASVSVQAAEIYNKDGNKLDVYGKVKAMHYMS
FT                   DNDSKDGDQSYIRFGFKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKY
FT                   KDLGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVI
FT                   DGLNLTLQYQGKNENRDVKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSR
FT                   GTGKRAEAWATGLKYDANNIYLATFYSETRKMTPITGGFANKTQNFEAVAQYQFDFGLR
FT                   PSLGYVLSKGKDIEGIGDEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNKLNINND
FT                   DIVAVGMTYQF"
     atgaaaaaga gcactctggc attagtggtg atgggcattg tggcatctgt atccgtacag        60
     gccgcagaaa tatataacaa agacggtaat aaactggatg tctatggcaa agttaaagcc       120
     atgcattata tgagtgataa tgacagtaaa gatggcgacc aaagttatat ccgttttggt       180
     tttaaaggcg aaacacaaat taacgatcaa ctgactggtt atggtcgttg ggaagctgag       240
     tttgccggta ataaagcgga gagtgatact gcacagcaaa aaacgcgtct cgcttttgcc       300
     gggttgaaat ataaagattt gggttctttc gattatggtc gtaacctggg cgcgttgtat       360
     gacgtggaag cctggaccga tatgttcccg gaatttggtg gcgactcctc ggcgcagacc       420
     gacaacttta tgaccaaacg cgccagcggt ctggcgacgt atcggaacac cgacttcttc       480
     ggcgttatcg atggcctgaa cttaaccctg caatatcaag ggaaaaacga aaaccgcgac       540
     gttaaaaagc aaaacggtga tggcttcggc acgtcattga catatgactt tggtggcagc       600
     gatttcgcca tcagtggagc ctataccaac tctgatcgca ccaacgagca gaacctgcaa       660
     agccgtggca caggcaagcg tgcagaagca tgggcaacag gtctgaaata cgatgccaat       720
     aatatttatc tggcaacttt ctattctgaa acacgcaaaa tgacgccaat aactggcggc       780
     tttgccaata agacacagaa ctttgaagcg gtcgcccaat accagtttga ctttggtctg       840
     cgtccgtcgc tgggttatgt cttatcgaaa gggaaagata ttgaaggaat cggtgatgaa       900
     gatctggtca attatatcga tgttggtgct acgtattatt tcaacaaaaa tatgtcggca       960
     tttgttgatt ataaaataaa ccaactggat agcgataata agctgaacat caataatgat      1020
     gatattgtcg cggttggcat gacctatcag ttttaa                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page