(data stored in ACNUC7421 zone)

EMBL: FM180568.PHOR

FM180568.PHOR        Location/Qualifiers
FT   CDS_pept        376932..378227
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="E2348C_0335"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07883"
FT                   /db_xref="GOA:B7UJM3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJM3"
FT                   /protein_id="CAS07883.1"
FT                   /translation="MLERLSWKRLVLELLLCCLPAFILGAFFGYLPWFLLASVTGLLIW
FT                   HFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGA
FT                   ESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPEDNGQNILNLLRYPEFTQYLKTRDFSR
FT                   PLNLVLNTGRHLEIRVMPYTHKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMDEQPLEGAVREKALHTMREQTQRMEGLVKQLLTLSKIEAAPTHLLNEKVDVP
FT                   MMLRVVEREAQTLSQKKQTVTFEIDNGLKVSGNEDQLRSAISNLVYNAVNHTPEGTHIT
FT                   VRWQRVPHGAEFSVEDNGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVN
FT                   HHESRLNIESTVGKGTRFSFVIPERLIAKNSD"
     gtgctggaac ggctgtcgtg gaaaaggctg gtgctggagc tgctactttg ctgcctcccg        60
     gctttcatcc tgggtgcatt ttttggttac ctgccctggt ttttgctggc atcggtaacg       120
     ggactgctta tctggcattt ctggaatttg ttgcgccttt catggtggct gtgggtggat       180
     cgcagtatga ccccgccacc ggggcgtggt agctgggaac cgctactata cggcttacac       240
     cagatgcagc tgcgaaataa aaaacgccgt cgtgaactgg gcaatctgat taaacgcttt       300
     cgtagcggcg cggagtcgct gcccgacgcg gtggtgctga ccacggaaga gggcggtatt       360
     ttctggtgca acggtctggc gcaacagatt cttggcttgc gctggccgga agataacggg       420
     cagaacatcc ttaacttgct gcgttacccg gagtttacgc aatatctgaa aacgcgtgat       480
     ttctctcgcc cgctcaatct ggtgctcaac accgggcggc atctggagat tcgcgtcatg       540
     ccttataccc acaaacagtt gctgatggtg gcgcgtgatg tcacgcaaat gcatcaactg       600
     gaaggggcgc ggcgtaactt ttttgccaat gtgagccatg agttacgtac gccattgacc       660
     gtgttacagg gttacctgga gatgatggat gagcaaccgc tggaaggcgc ggtacgtgaa       720
     aaagcgttgc acaccatgcg cgagcagacc cagcggatgg aagggttggt gaagcaattg       780
     ctgacgctgt cgaaaataga agccgcaccg acgcatttgc tcaatgaaaa ggttgatgtg       840
     ccgatgatgc tgcgcgtcgt tgagcgcgag gctcagactc tgagtcagaa aaaacagaca       900
     gttacctttg agatagataa cggcctcaag gtgtcaggca acgaagatca gctacgcagt       960
     gcgatttcga acctggtcta taacgccgtg aatcatacgc cggaaggcac gcatatcacc      1020
     gtacgctggc agcgagtgcc gcacggtgcc gaatttagtg ttgaagataa cggaccgggc      1080
     attgcaccgg agcatattcc gcgcctgacc gagcgttttt atcgcgttga taaagcgcgt      1140
     tcccggcaaa ccggtggtag cggattaggg ttagcgatcg tgaaacatgc ggtgaatcat      1200
     cacgaaagtc gcctgaatat tgagagtaca gtaggaaaag gtacacgttt cagttttgtt      1260
     atcccggaac gtttaattgc caaaaacagc gattaa                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page