(data stored in ACNUC7421 zone)

EMBL: FM180568.PPDD

FM180568.PPDD        Location/Qualifiers
FT   CDS_pept        complement(123107..123547)
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="E2348C_0111"
FT                   /product="predicted major pilin subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07659"
FT                   /db_xref="GOA:B7UIF6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIF6"
FT                   /protein_id="CAS07659.1"
FT                   /translation="MDKQRGFTLIELMVVIGIIAILSTIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGLNTCDGGSNGIPSPTTTRYVSAMSVAKGVVSLTGQESLNGLS
FT                   VVMTPGWDNANGVTGWTRNCNIQSDSALQQACEDVFRFDDAN"
     atggacaagc aacgcggttt tacacttatc gaactgatgg tggttattgg catcattgcc        60
     attttaagca ccattggtat tcccgcttat caaaactacc tgcgcaaagc cgcactcacc       120
     gacatgctac aaacctttgt gccttaccgt accgccgtag agttgtgcgc gctggaacat       180
     ggtggattaa atacctgtga cggtggcagc aatggcattc cctcgcctac caccacccgc       240
     tatgtttcag ccatgagtgt ggcaaagggc gtggtgtcgc tgaccgggca agaaagtctc       300
     aatgggctaa gcgtcgtcat gacaccgggt tgggataacg caaacggcgt caccggctgg       360
     acgcgtaact gcaatattca aagtgacagc gcattgcagc aagcctgcga agatgtcttc       420
     cgctttgatg acgccaacta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page