(data stored in ACNUC7421 zone)

EMBL: FM180568.PRFH

FM180568.PRFH        Location/Qualifiers
FT   CDS_pept        260893..261474
FT                   /transl_table=11
FT                   /gene="prfH"
FT                   /locus_tag="E2348C_0229"
FT                   /product="predicted peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07777"
FT                   /db_xref="GOA:B7UJC4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR017509"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJC4"
FT                   /protein_id="CAS07777.1"
FT                   /translation="MILLQLSSAQGPEECCLAVKKALDRLIKEAARQDVAVTVLETETG
FT                   RYSDTLRSALVSLDGDNAWALSESWCGTIQWICPSPYRPHHGRKNWFLGIGRFTADEQE
FT                   QSDAIRYETLRSSGPGGQHVNKTDSAVRATHLASGISVKVQSERSQHANKRLARLLIAW
FT                   KLEQQQQENSAALKSQRRMFHHQIERGNPR"
     atgatcttgc tacaactctc ctcagctcag gggccggaag aatgttgtct cgcagtgaaa        60
     aaggcactgg acaggctgat taaagaagct gcccgacaag acgtcgcggt aacggtgctg       120
     gaaacagaaa cgggtcgcta ctctgacaca ctacgttcgg cgctggtttc acttgatggc       180
     gacaacgcat gggctctaag cgaaagctgg tgcggcacta ttcagtggat ttgtccgagt       240
     ccgtatcggc ctcatcatgg gcgcaaaaac tggtttctgg gcattgggcg ttttaccgct       300
     gatgagcagg aacaatcgga tgcaatccgt tatgagacgc tgcgttcgtc ggggccgggc       360
     ggtcaacatg tcaataaaac cgactcggcg gtacgcgcca cgcatctggc atccggtatt       420
     agcgtgaagg ttcagtcaga gcgcagtcag catgctaaca aacggctggc gcgattactg       480
     attgcctgga agctggaaca acagcaacag gaaaatagcg cggcgctgaa atcgcagcgg       540
     cgaatgttcc atcaccagat tgaacgtggc aacccgcgat ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page