(data stored in ACNUC7421 zone)

EMBL: FM180568.PRIC

FM180568.PRIC        Location/Qualifiers
FT   CDS_pept        complement(450762..451289)
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="E2348C_0402"
FT                   /product="primosomal replication protein N''"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07950"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKE7"
FT                   /protein_id="CAS07950.1"
FT                   /translation="MKTTLLLEKLEGQLATLRQRCAPVAQFATLSARFDRHLFQTRATT
FT                   LQACLDEAGDNLAALRHAVEQQQLPQVAWLAEHLAAQLEAIAREATAWSLREWDSAPPK
FT                   IARWQRKRIQHQDFERRLREMVAERRARLARATALVEQQTLHREVEAYEARLARCRHAL
FT                   EKIENRLARLTR"
     gtgaaaacca ccctgctact ggaaaaactg gaaggacagc tcgccacgct gcgtcagcgt        60
     tgtgccccgg tagcgcaatt tgccacgcta agtgcccgtt ttgacaggca cctttttcag       120
     acccgtgcga caacactaca ggcttgtctc gatgaggcgg gcgataacct ggctgcgctt       180
     cgtcatgcgg ttgagcagca acagctgccg caagtcgcct ggctggcaga acatctggcg       240
     gcgcaactgg aggctatagc gcgtgaagcc acagcctggt cgctacgcga gtgggatagc       300
     gcaccaccga aaattgcccg ctggcagcgt aaacgtattc agcatcagga ttttgagcgg       360
     cggctacgtg agatggttgc cgaacgtaga gcccgtctgg cgcgagcgac cgctctcgtg       420
     gaacagcaga cactgcatcg tgaagtggaa gcctatgaag cgcgcctggc acgctgccgc       480
     catgcgctgg aaaaaatcga aaacaggtta gcgcgtttaa cccgctag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page