(data stored in ACNUC7421 zone)

EMBL: FM180568.PROB

FM180568.PROB        Location/Qualifiers
FT   CDS_pept        266918..268021
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="E2348C_0235"
FT                   /product="gamma-glutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07783"
FT                   /db_xref="GOA:B7UJD0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJD0"
FT                   /protein_id="CAS07783.1"
FT                   /translation="MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRI
FT                   VIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLT
FT                   RADMEDRERFLNARDTLRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGAD
FT                   KLLLLTDQKGLYTADPRSNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAAD
FT                   VACRAGIDTIIAAGSKPGVIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVD
FT                   EGATAAILERGSSLLPKGIKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAG
FT                   HHSQEIDAILGYEYGPVAVHRDDMITR"
     atgagtgaca gccagacgct ggtggtaaaa ctcggcacca gtgtgctaac aggcggatcg        60
     cgccgcctga accgtgccca tatcgttgaa cttgttcgcc agtgcgcgca gttacatgcc       120
     gccgggcatc ggattgttat tgtgacgtcg ggtgcgattg ccgccggacg tgagcacctg       180
     gggtacccgg aattgccagc gactatcgct tcaaaacagc tgctggcggc ggtagggcag       240
     agtcgactga ttcaactgtg ggaacagctg ttttcaattt acggcattca tgtcgggcag       300
     atgttgctga cccgtgctga tatggaagat cgtgaacgct tcctgaacgc ccgcgatacc       360
     ctgcgtgcgt tgctcgataa caatatcgtt ccggtaatta atgagaacga tgctgtcgct       420
     actgcagaga ttaaggtcgg tgataacgat aacctttctg cgctggcggc gattctggcg       480
     ggtgccgata aactgttgct gctgaccgat caaaaaggtt tgtataccgc tgacccgcgc       540
     agcaatccgc aggcagaact gattaaagat gtgtacggca ttgatgacgc actgcgcgcg       600
     attgccggtg atagcgtttc aggcctcgga actggcggca tgagcaccaa attgcaggcc       660
     gctgacgtgg cttgccgtgc gggtatcgac accattattg ccgcgggcag caagccgggc       720
     gttattggtg atgtgatgga aggcatttcc gtcggtacgc tgttccatgc ccaggcgact       780
     ccgcttgaaa accgtaaacg ctggattttc ggtgcgccgc ctgcgggtga aatcacggta       840
     gatgaagggg caactgccgc cattctggaa cgcggcagct ccctgttgcc gaaaggcatt       900
     aaaagcgtga ctggcaattt ctcgcgtggt gaagtcatcc gtatttgcaa cctcgaaggt       960
     cgcgatatcg cccacggcgt cagtcgttac aacagcgatg cattacgccg tattgccgga      1020
     caccactcgc aagaaattga tgcaatactg ggatatgaat acggcccggt tgccgttcac      1080
     cgtgatgaca tgattacccg ttaa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page