(data stored in ACNUC7421 zone)

EMBL: FM180568.PRPE

FM180568.PRPE        Location/Qualifiers
FT   CDS_pept        331130..332941
FT                   /transl_table=11
FT                   /gene="prpE"
FT                   /locus_tag="E2348C_0294"
FT                   /product="predicted propionyl-CoA synthetase with ATPase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07842"
FT                   /db_xref="GOA:B7UJI4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR012694"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJI4"
FT                   /protein_id="CAS07842.1"
FT                   /translation="MSFSEFYQRSINEPEQFWAEQARRIDWQTPFTQTLDHSNPPFARW
FT                   FCEGRTNLCHNAIDRWLEKQPGALALIAVSSETEEERTFTFRQLHDEVNAVASMLRSLG
FT                   VQRGDRVLVYMPMIAEAHITLLACARIGAIHSVVFGGFASHSVAARIDDAKPVLIVSAD
FT                   AGARGGKIIPYKKLLDDAISQAQHQPRHVLLVDRGLAKMARVSGRDVDFASLRHQHIGA
FT                   RVPVAWLESNETSCILYTSGTTGKPKGVQRDVGGYAVALATSMDTIFGGKAGGVFFCAS
FT                   DIGWVVGHSYIVYAPLLAGMATIVYEGLPTWPDCGVWWKIVEKYQVSRMFSAPTAIRVL
FT                   KKFPTAEIRKHDLSSLEVLYLAGEPLDEPTASWVSNTLDVPVIDNYWQTESGWPIMAIA
FT                   RGLDDRPTRLGSPGVPMYGYNVQLLNEVTGEPCGVNEKGMLVVEGPLPPGCIQTIWGDD
FT                   DRFVKTYWSLFSRPVYATFDWGIRDADGYHFILGRTDDVINVAGHRLGTREIEESISSH
FT                   PVVAEVAVVGVKDALKGQVAVAFVIPKESDSLEDREVAHSQEKAIMALVDSQIGNFGRP
FT                   AHVWFVSQLPKTRSGKMLRRTIQAMEE"
     atgtctttta gcgaatttta tcagcgttcg attaacgaac cggagcagtt ctgggccgag        60
     caggcccggc gtattgactg gcagacgccc tttacgcaaa cgctcgacca cagcaacccg       120
     ccgtttgccc gttggttttg tgaaggccga accaacttgt gtcacaacgc tatcgatcgc       180
     tggctggaga aacagccagg ggcgctggca ttgattgccg tctcttcgga aacagaggaa       240
     gagcgtacct ttaccttccg ccagttacat gacgaagtga atgcggtggc gtcaatgctg       300
     cgctcactgg gcgtgcagcg tggcgatcgg gtgctggtgt atatgccgat gattgccgaa       360
     gcgcatatta ccctgctggc ctgcgcgcgc attggcgcta ttcattcggt ggtgtttggg       420
     ggatttgctt cgcacagcgt ggcggcgcga attgatgacg ctaaaccggt gctgattgtc       480
     tcggctgatg ccggggcgcg cggtggcaaa atcattccgt ataaaaaatt gctcgacgat       540
     gcgataagtc aggcacagca tcagccgcgt cacgttttac tggtggatcg cgggctggcg       600
     aaaatggcgc gcgttagcgg gcgggatgtc gatttcgcgt cgttgcgcca tcagcacatc       660
     ggcgcgcggg tgccggtggc atggctggaa tccaacgaaa cctcctgcat tctctacacc       720
     tccggcacga ccggcaaacc taaaggtgtg cagcgtgatg tcggcggata tgcggtggcg       780
     ctggcgacct cgatggacac catttttggc ggcaaagcgg gcggcgtgtt cttttgtgct       840
     tcggatatcg gctgggtggt agggcattcg tatatcgttt acgcgccgct gctggcgggg       900
     atggcgacta tcgtttacga aggattgccg acctggccgg actgcggcgt gtggtggaaa       960
     attgtcgaga aatatcaggt tagccgcatg ttctcagcgc cgaccgccat tcgcgtgctg      1020
     aaaaaattcc ctaccgctga aattcgcaaa cacgatcttt cgtcgctgga agtgctctat      1080
     ctggctggag aaccgctgga cgagccgacc gccagttggg tgagcaatac gctggatgtg      1140
     ccggtcatcg acaactactg gcagaccgaa tccggctggc cgattatggc gattgctcgc      1200
     ggtctggatg acaggccgac gcgtctggga agccccggcg tgccgatgta tggctataac      1260
     gtgcagttgc tcaatgaagt caccggcgaa ccgtgtggcg tcaatgagaa agggatgctg      1320
     gtagtggagg ggccattgcc gccaggctgt attcagacca tctggggcga cgacgaccgc      1380
     tttgtgaaga cgtactggtc gctgttttcc cgtccggtgt acgccacttt tgactggggc      1440
     atccgcgatg ctgacggtta tcactttatt ctcgggcgca ctgacgatgt gattaacgtt      1500
     gccggacatc ggctgggtac gcgtgagatt gaagagagta tctccagtca tccggtcgtt      1560
     gccgaagtgg cggtggttgg ggtgaaagat gcgctgaaag ggcaggtggc ggtggcgttt      1620
     gtcattccga aagagagcga cagtctggaa gaccgtgagg tggcgcactc gcaagagaag      1680
     gcgattatgg cgctggtgga cagccagatt ggcaactttg gccgcccggc gcacgtctgg      1740
     tttgtctcgc aattgccaaa aacgcgatcc ggaaaaatgc tgcgccgcac gatccaggcg      1800
     atggaagagt ag                                                          1812
//

If you have problems or comments...

PBIL Back to PBIL home page