(data stored in ACNUC7421 zone)

EMBL: FM180568.PSIF

FM180568.PSIF        Location/Qualifiers
FT   CDS_pept        362437..362757
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="E2348C_0320"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07868"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJK8"
FT                   /protein_id="CAS07868.1"
FT                   /translation="MKITLLVTLLFGLVFLTTVGAAERTLTPQQQRMTSCNQQATAQAL
FT                   KGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKK
FT                   AA"
     atgaaaatta cattactggt taccttgctt ttcggtctgg tttttttaac caccgtcggc        60
     gctgccgaga gaaccttaac cccacaacaa cagcgtatga cctcttgtaa tcagcaggcg       120
     acggcgcagg cgttgaaagg ggatgctcgt aagacctaca tgagtgattg cctgaagaac       180
     agcaaatctg cgcctggtga aaaaagtttg acgccacagc agcaaaagat gcgcgaatgt       240
     aataatcaag caacacaaca atctctgaaa ggggatgatc gtaataagtt tatgagtgcc       300
     tgcctcaaga aagccgcctg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page