(data stored in ACNUC7421 zone)

EMBL: FM180568.QUEC

FM180568.QUEC        Location/Qualifiers
FT   CDS_pept        complement(423769..424464)
FT                   /transl_table=11
FT                   /gene="queC"
FT                   /locus_tag="E2348C_0379"
FT                   /product="predicted aluminum resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07927"
FT                   /db_xref="GOA:B7UJR7"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJR7"
FT                   /protein_id="CAS07927.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQRHRAEIDV
FT                   ARELALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPEADGIPNTFVPGRNILFL
FT                   TLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKALNHAVSLGMAKDIRFETPLMWI
FT                   DKAETWALADYYGKLDLVRNETLTCYNGIKGDGCGHCAACNLRANGLNHYLADKPTVMA
FT                   AIKQKTGLK"
     atgaaacgtg ctgtcgttgt gttcagtgga ggccaggatt ccaccacctg tctggtgcag        60
     gcattacaac aatatgatga agtccattgc gtgacgttcg attacggtca acgccatcgc       120
     gcagaaatcg acgtggcacg cgaactagcg ctgaaactgg gggcacgcgc gcataaggtg       180
     cttgatgtaa cgctgctcaa cgagctggcg gtcagcagcc tgacgcgtga cagcattccg       240
     gtgcctgatt atgaacctga agccgatggt atcccgaata cgtttgtccc agggcgtaat       300
     attttgttcc tgacgctggc ggcaatatat gcgtatcagg taaaagcaga agccgtaatt       360
     accggcgtct gcgaaacgga tttctccggc tacccggatt gccgcgatga gtttgtgaaa       420
     gcactaaacc atgccgtcag tttgggcatg gcgaaagata ttcgttttga aacgccgctg       480
     atgtggattg ataaagcgga aacctgggcg ctggcagatt attacggcaa gctggattta       540
     gtccgtaacg aaacgctgac ctgttataac ggcattaaag gcgacggttg cggtcattgt       600
     gcggcgtgta atttacgtgc caacggtttg aatcattatc tggccgataa accgacggtg       660
     atggcagcga taaagcagaa aaccgggttg aagtaa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page