(data stored in ACNUC7421 zone)

EMBL: FM180568.RECR

FM180568.RECR        Location/Qualifiers
FT   CDS_pept        454882..455487
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="E2348C_0407"
FT                   /product="gap repair protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07955"
FT                   /db_xref="GOA:B7UKF2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UKF2"
FT                   /protein_id="CAS07955.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   ALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQ
FT                   YDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF"
     atgcaaacca gcccgctgtt aacacagctt atggaagcac tgcgctgtct gccgggcgtt        60
     ggcccgaagt cggcgcagcg tatggcgttc acgctgcttc agcgcgatcg tagcggcggg       120
     atgcgtctgg cgcaggcgct cacccgggcg atgtcggaaa tcggccactg cgccgattgc       180
     cgcaccttca ccgaacagga agtctgtaac atctgttcga atccacgtcg tcaggaaaac       240
     ggtcaaatct gcgtggtgga gagtccggcg gacatttacg ccattgagca gacggggcag       300
     ttttcaggtc gttattttgt gttgatgggg catctgtcac cgctggacgg catcggtcct       360
     gatgatatcg ggcttgatcg tctggaacag cgtctggcag aggaaaaaat cactgaagtg       420
     atcctcgcca ccaaccccac ggttgaaggt gaagctaccg ctaactacat tgccgagctt       480
     tgtgcgcaat atgacgtgga agccagccga atcgctcatg gcgtaccggt tggcggcgaa       540
     ctggaaatgg tcgatggcac cacgctgtca cactcccttg ccgggcgtca taagattcgt       600
     ttttaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page