(data stored in ACNUC7421 zone)

EMBL: FM180568.RIBF

FM180568.RIBF        Location/Qualifiers
FT   CDS_pept        24336..25277
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="E2348C_0025"
FT                   /product="bifunctional riboflavin kinase/FAD synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07573"
FT                   /db_xref="GOA:B7UI70"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI70"
FT                   /protein_id="CAS07573.1"
FT                   /translation="MKLIRGIHNLSQAPQEGCVLTIGNFDGVHRGHRALLQGLQEEGRK
FT                   RNLPVMVMLFEPQPLELFATDKAPARLTRLREKLRYLAECGVDYVLCVRFDRRFAALTA
FT                   QNFISDLLVRHLRVKFLAVGDDFRFGAGREGDFLLLQKAGMEYGFDITSTQTFCEGGVR
FT                   ISSTAVRQALADDNLALAESLLGHPFAISGRVVHGDELGRTIGFPTANVPLRRQVSPVK
FT                   GVYAVEVLGLGEKPLPGVANIGTRPTVAGIRQQLEVHLLDVAMDLYGRHIQVVLRKKIR
FT                   NEQRFASLDELKAQIARDELTAREFFGLTKPA"
     atgaagctga tacgcggcat acataatctc agccaggccc cgcaagaagg gtgtgtgctg        60
     actattggta atttcgacgg cgtgcatcgc ggtcatcgcg cgctgttaca gggcttgcag       120
     gaagaagggc gcaagcgcaa cttaccggtg atggtgatgc tttttgaacc tcaaccactg       180
     gaactgtttg ctactgataa agccccggca cggctgaccc ggctgcggga aaaactgcgt       240
     tatcttgcag agtgtggcgt tgattacgtg ctgtgcgtgc gttttgacag gcgttttgcg       300
     gcgttaaccg cgcaaaactt catcagtgat cttctggtga ggcacttgcg ggtaaaattt       360
     cttgccgtag gtgacgattt ccgctttggc gctggtcgtg aaggcgattt cttgttatta       420
     cagaaagcgg gcatggaata cggcttcgat atcaccagca cgcaaacttt ttgcgaaggt       480
     ggcgtgcgta tcagcagcac cgccgtgcgt caggcgctgg cggatgacaa tctggctctg       540
     gcagaaagtt tactggggca cccgtttgct atctccgggc gtgtagtcca cggtgatgaa       600
     ttagggcgca ctataggttt cccgacggcg aatgtaccgc tacgccgtca ggtttccccg       660
     gtgaaagggg tgtatgcggt agaagtgttg ggccttggcg aaaagccgtt acccggcgtt       720
     gcaaacatcg gaacacgccc aacggttgcc ggtattcgcc agcaactgga agtgcatttg       780
     ttagatgttg caatggacct ttatggtcgc catatacaag tagtgctgcg taaaaaaata       840
     cgcaatgagc agcgatttgc atcgctggac gaactgaaag cgcagattgc gcgtgatgaa       900
     ttaaccgccc gcgaattttt tgggctaaca aaaccggctt aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page