(data stored in ACNUC7421 zone)

EMBL: FM180568.SDHA

FM180568.SDHA        Location/Qualifiers
FT   CDS_pept        670233..671999
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="E2348C_0603"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08151"
FT                   /db_xref="GOA:B7ULK0"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULK0"
FT                   /protein_id="CAS08151.1"
FT                   /translation="MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSH
FT                   TVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGL
FT                   PFSRLDDGRIYQRPFGGQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSE
FT                   WYALDLVKNQDGAVVGCTALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDG
FT                   VGMAIRAGVPVQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAK
FT                   DLAGRDVVARSIMIEIREGRGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHV
FT                   DPVKEPIPVIPTCHYMMGGIPTKVTGQALTVNEKGEDVVVPGLFAVGEIACVSVHGANR
FT                   LGGNSLLDLVVFGRAAGLHLQESIAEQGALRDASESDVEASLDRLNRWNSNRNGEDPVA
FT                   IRKALQECMQHNFSVFREGDAMAKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELD
FT                   NLMETAYATAVSANFRTESRGAHSRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPK
FT                   LRPAFPPKIRTY"
     atgaaattgc cagtcagaga atttgatgca gttgtgattg gtgctggcgg cgcaggtatg        60
     cgcgcggcgc tgcaaatttc ccagagtggc cagacctgtg cgctgctctc taaagtcttc       120
     ccgacccgtt cccataccgt ttctgcgcaa ggtggtatta ccgttgcgct gggtaatacc       180
     catgaagata actgggaatg gcatatgtac gacaccgtaa aagggtcgga ctatatcggt       240
     gaccaggacg cgattgaata tatgtgtaaa accgggccgg aagcgattct ggaactggaa       300
     catatgggcc tgccgttctc gcgtcttgat gatggtcgta tctatcaacg tccgtttggc       360
     ggccagtcga aaaacttcgg cggcgagcag gcggcacgta ctgctgcggc tgccgaccgt       420
     accggtcacg cactgctgca cacgctttat cagcagaacc tgaaaaacca caccactatt       480
     ttctccgagt ggtatgcgtt ggatctggtg aaaaaccagg atggcgcagt ggtcggttgt       540
     accgcactgt gcatcgaaac tggtgaagtg gtttacttta aagctcgcgc gacagtgctg       600
     gcgactggcg gggcagggcg tatttatcag tccaccacca acgcccacat taacactggc       660
     gacggtgtcg gcatggctat ccgtgcaggc gtaccggtac aggatatgga aatgtggcag       720
     ttccacccga ccggtattgc cggtgcgggc gtactggtca ccgaaggttg ccgtggtgaa       780
     ggcggttatc tgctgaacaa acatggcgaa cgctttatgg agcgttatgc gccgaacgcc       840
     aaagacctgg cgggccgtga cgtggtggcg cgttccatca tgatcgaaat ccgtgaaggc       900
     cgcggctgtg atggtccgtg ggggccacac gcaaaactga aacttgacca tctggggaaa       960
     gaagttctcg aatcccgtct gccgggtatt ctggaactct cccgcacctt cgctcacgtt      1020
     gatccggtga aagagccgat tccggtaatt ccaacctgtc actacatgat gggcggtatt      1080
     ccgaccaaag tgaccggtca ggcgctgact gtgaatgaga aaggcgaaga tgtggttgtt      1140
     ccggggctgt ttgccgttgg tgaaatcgct tgtgtatcgg tacacggcgc taaccgtctg      1200
     ggcggcaact cgctgctgga cctggtcgta tttggtcgag cggcaggtct gcatctgcaa      1260
     gaatccatcg ccgagcaggg cgcactgcgc gatgccagcg agtctgatgt agaagcgtct      1320
     ctggatcgcc tgaaccgctg gaacagtaac cgtaacggtg aagatccggt ggcgatccgt      1380
     aaagcactgc aagaatgtat gcagcataac ttctcggtct tccgtgaagg tgatgcgatg      1440
     gcgaaagggc ttgagcagtt gaaagttatc cgcgagcgtt tgaaaaatgc ccgtctggat      1500
     gacacttcca gtgagttcaa tacccagcgc gttgagtgcc tggaactgga taacctgatg      1560
     gaaacggcgt atgcaacggc tgtttctgcc aacttccgta ccgaaagccg tggcgcgcat      1620
     agccgcttcg acttcccgga tcgcgatgat gaaaactggc tgtgccactc cctgtatctg      1680
     ccagagtcgg aatccatgac gcgccgaagc gtcaacatgg aaccgaaact gcgcccggca      1740
     ttcccgccga agattcgtac ttactaa                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page