(data stored in ACNUC7421 zone)

EMBL: FM180568.SDHB

FM180568.SDHB        Location/Qualifiers
FT   CDS_pept        672015..672731
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="E2348C_0604"
FT                   /product="succinate dehydrogenase, FeS subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08152"
FT                   /db_xref="GOA:B7ULK1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULK1"
FT                   /protein_id="CAS08152.1"
FT                   /translation="MRLEFSIYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEK
FT                   DPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLV
FT                   VDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFW
FT                   WNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNP
FT                   TRAIGHIKSMLLQRNA"
     atgagactcg agttttcaat ttatcgctat aacccggatg ttgatgatgc tccgcgtatg        60
     caggattaca ccctggaagc ggaagaaggt cgcgacatga tgctgctgga tgcgcttatt       120
     cagctgaaag agaaagatcc cagcctgtcg ttccgccgct cctgccgtga aggtgtgtgc       180
     ggttccgatg gtctgaacat gaacggtaag aatggtctgg cctgtattac cccgatttcg       240
     gcactcaacc agccgggcaa gaagattgtg attcgcccgc tgccaggttt accggtgatc       300
     cgcgatttgg tggtagacat gggacaattc tatgcgcaat atgagaaaat taagccttac       360
     ctgttgaata atggacaaaa tccgccagct cgcgagcatt tacagatgcc agagcagcgc       420
     gaaaaactcg acgggttgta tgaatgtatt ctctgcgcat gttgttcaac ctcttgtccg       480
     tctttctggt ggaatcccga taagtttatc ggcccggcag gcttgctagc ggcatatcgt       540
     ttcctgatcg atagccgtga taccgagact gacagccgcc tcgacggttt gagcgatgca       600
     ttcagtgtat tccgctgtca cagcatcatg aactgcgtca gtgtatgtcc gaaggggctg       660
     aacccgacgc gcgccatcgg ccatatcaag tcgatgttgt tgcaacgtaa tgcgtaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page