(data stored in ACNUC7421 zone)

EMBL: FM180568.SDHC

FM180568.SDHC        Location/Qualifiers
FT   CDS_pept        669503..669892
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="E2348C_0601"
FT                   /product="succinate dehydrogenase, membrane subunit, binds
FT                   cytochrome b556"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08149"
FT                   /db_xref="GOA:B7ULJ8"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULJ8"
FT                   /protein_id="CAS08149.1"
FT                   /translation="MIRNVKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILL
FT                   WLLGTSLSSPEGFEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFE
FT                   AGKRSAKISFVITVVFSLLAGVLVW"
     atgataagaa atgtgaaaaa acaaagacct gttaatctgg acctacagac catccggttc        60
     cccgtcacgg cgatagcgtc cattctccat cgcgtttccg gtgtgatcac ctttgttgca       120
     gtgggcatcc tgctgtggct tctgggtacc agcctctctt cccctgaagg tttcgagcaa       180
     gcttccgcga ttatgggcag cttcttcgtc aaatttatca tgtggggcat ccttaccgct       240
     ctggcatatc acgtcgtcgt aggtattcgc cacatgatga tggattttgg ctatctggaa       300
     gaaacattcg aagcgggtaa acgctccgcc aaaatctcct ttgttattac tgtcgtgttt       360
     tcacttctcg caggagtcct cgtatggtaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page