(data stored in ACNUC7421 zone)

EMBL: FM180568.SDHD

FM180568.SDHD        Location/Qualifiers
FT   CDS_pept        669886..670233
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="E2348C_0602"
FT                   /product="succinate dehydrogenase, membrane subunit, binds
FT                   cytochrome b556"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08150"
FT                   /db_xref="GOA:B7ULJ9"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULJ9"
FT                   /protein_id="CAS08150.1"
FT                   /translation="MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTY
FT                   EVWIGFFASAFTKVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVY
FT                   VIYGFVVVWGV"
     atggtaagca acgcctccgc attaggacgc aatggcgtac atgatttcat cctcgttcgt        60
     gctaccgcta tcgtcctgac gctctacatc atttatatgg tcggtttttt cgctaccagt       120
     ggcgaactga catatgaagt ctggattggt ttcttcgcct ctgcgttcac caaagtgttc       180
     accctgctgg cgctgttttc tatcttgatc catgcctgga tcggcatgtg gcaggtgttg       240
     accgactacg ttaaaccgct ggccttgcgc ctgatgctgc aactggtgat tgtcgttgca       300
     ctggtggttt acgtgattta tggattcgtt gtggtgtggg gtgtgtga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page