(data stored in ACNUC7421 zone)

EMBL: FM180568.SECA

FM180568.SECA        Location/Qualifiers
FT   CDS_pept        114395..117100
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="E2348C_0103"
FT                   /product="preprotein translocase subunit SecA, ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07651"
FT                   /db_xref="GOA:B7UIE8"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UIE8"
FT                   /protein_id="CAS07651.1"
FT                   /translation="MLIKLLTKVFGSRNDRTLRRMRKVVNIINAMEPEIEKLSDEELKG
FT                   KTAEFRARLEKGEVLENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRT
FT                   GEGKTLTATLPAYLNALTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTVGINLPGMPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYKRVNKIIPHLIRQEKEDSETFQGEGHFSVDEKSRQVNLTERGLVL
FT                   IEELLVKEGIMDEGESLYSPANIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVQIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTAKGQPVLVGTIS
FT                   IEKSELVSNELTKAGIKHNVLNAKFHANEAAIVAQAGYPAAVTIATNMAGRGTDIVLGG
FT                   SWQAEVAALENPTAEQIEKIKADWQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDAGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYSQRNELLDVSDVSETINSIREDVFKATIDAYIPP
FT                   QSLEEMWDIPGLQERLKNDFDLDLPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFSMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEELEQQRRMEAERLAQMQQLSHQDDDSAAAAALA
FT                   AQTGERKVGRNDPCPCGSGKKYKQCHGRLQ"
     atgctaatca aattattaac taaagttttc ggtagtcgta acgatcgcac cctgcgccgg        60
     atgcgcaaag tggtcaacat catcaatgcc atggaaccgg agattgaaaa actctccgac       120
     gaagaactga aaggaaaaac ggcagagttc cgcgcgcgtc tggaaaaagg cgaagtgctg       180
     gaaaacttga tcccggaagc cttcgccgtg gtgcgtgaag ccagtaagcg tgtttttggc       240
     atgcgccact tcgacgtaca gctgctcggc ggtatggttc ttaacgaacg ctgcatcgcc       300
     gaaatgcgta ccggtgaagg taaaaccctg accgcaacgc tgcctgctta cctgaacgca       360
     ctaaccggta aaggcgtaca cgtcgttacc gtcaacgact acctggcgca acgtgacgcc       420
     gaaaacaacc gtccgctgtt tgaattcctt ggcctgactg tcggtatcaa cctgccgggc       480
     atgccagcac cggcaaagcg tgaagcctac gctgctgaca tcacttacgg tacgaacaac       540
     gaatacggct ttgactacct gcgcgacaac atggcgttca gtcctgaaga acgtgtacag       600
     cgtaaactgc actatgcgct ggtggacgaa gtggactcca tcctgatcga tgaagcgcgt       660
     acaccgctga tcatttctgg tccggcagaa gacagctcgg aaatgtataa acgcgtgaat       720
     aaaattattc cgcacctgat ccgtcaggaa aaagaagact ccgaaacctt ccagggcgaa       780
     ggccacttct cggtggatga aaaatctcgc caggtgaacc tgaccgaacg tggtctggtt       840
     ctgattgaag aactgctggt taaagaaggc atcatggatg aaggggagtc tctgtactct       900
     ccggccaaca tcatgctgat gcaccacgta acggcggcgc tgcgcgctca tgcgctgttt       960
     acccgtgacg tcgactacat cgttaaagat ggtgaagtta tcatcgttga cgaacacacc      1020
     ggtcgtacca tgcagggccg tcgctggtcc gatggtctgc accaggctgt ggaagcgaaa      1080
     gaaggtgtgc agatccagaa cgaaaaccag acgctggctt cgatcacctt ccagaactac      1140
     ttccgtctgt atgaaaaact ggcggggatg actggtactg ctgataccga agctttcgaa      1200
     ttcagctcca tctataagct ggatactgtc gttgttccga ccaaccgtcc aatgattcgt      1260
     aaagatctgc cggacctggt ctacatgact gaagcggaaa aaattcaggc gatcattgaa      1320
     gatatcaaag aacgtactgc gaaaggccag ccggtgctgg tgggtacaat ctccatcgaa      1380
     aaatcggagc tggtgtcaaa cgaattgacc aaagccggta ttaagcacaa cgtcctgaac      1440
     gccaaattcc atgccaacga agcggcgatt gttgctcagg caggttaccc ggctgcggtg      1500
     actatcgcga ccaacatggc gggtcgtggt accgatattg tgctcggtgg tagctggcag      1560
     gcagaagttg ccgcgctgga aaatccgact gcagagcaaa ttgaaaaaat taaagccgac      1620
     tggcaggtac gtcacgatgc ggtactggca gcaggtggcc tgcatatcat cggtactgaa      1680
     cgtcacgaat cccgtcgtat cgataaccag ctgcgcggtc gttctggtcg tcagggggat      1740
     gctggttctt cccgtttcta cctgtcgatg gaagatgcgc tgatgcgtat ttttgcttcc      1800
     gaccgagtat ccggcatgat gcgtaaactg ggtatgaagc caggcgaagc cattgagcac      1860
     ccgtgggtga ccaaagcgat tgccaacgcc cagcgtaaag ttgaaagccg taacttcgac      1920
     attcgtaagc aactgctgga atatgatgac gtggctaacg atcagcgtcg cgccatttac      1980
     tcccagcgta acgaactgct ggatgtcagc gatgtgagcg aaaccatcaa cagcattcgt      2040
     gaagatgtgt tcaaagcgac cattgatgcc tacattccgc cacagtcgct ggaagaaatg      2100
     tgggatattc cggggctgca ggaacgtctg aagaacgatt tcgacctcga tttaccaatt      2160
     gccgagtggc tggataaaga accagaactg catgaagaga cgctgcgtga gcgcattctg      2220
     gcgcagtcca tcgaagtgta tcagcgtaaa gaagaagtgg ttggtgctga gatgatgcgt      2280
     catttcgaga aaggcgtcat gctgcaaacg cttgactctc tgtggaaaga gcacctggct      2340
     gcgatggact atctgcgtca gggtatccac ctgcgtggct atgcacagaa agatccgaag      2400
     caggaataca aacgtgaatc gttctccatg tttgcagcga tgctggagtc gttaaaatat      2460
     gaagttatca gcacgctgag caaagttcag gtacgtatgc ctgaagaggt tgaggagctg      2520
     gaacaacagc gtcgtatgga agccgagcgt ttagcgcaaa tgcagcagct tagccatcag      2580
     gatgacgact ctgctgccgc agctgcactg gcggcgcaaa ccggtgaacg caaagtagga      2640
     cgtaacgatc cttgcccgtg tggttctggt aaaaaataca agcagtgcca tggccgcctg      2700
     caataa                                                                 2706
//

If you have problems or comments...

PBIL Back to PBIL home page