(data stored in ACNUC7421 zone)

EMBL: FM180568.SUCC

FM180568.SUCC        Location/Qualifiers
FT   CDS_pept        677170..678336
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="E2348C_0607"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08155"
FT                   /db_xref="GOA:B7ULK4"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULK4"
FT                   /protein_id="CAS08155.1"
FT                   /translation="MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVV
FT                   KCQVHAGGRGKAGGVKVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDI
FT                   AKELYLGAVVDRSSRRVVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGREL
FT                   AFKLGLEGKLVQQFTKIFMGLATIFLERDLALIEINPLVITKQGDLVCLDGKLGADGNA
FT                   LFRQPDLREMRDQSQEDPREAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGG
FT                   EPANFLDVGGGATKERVTEAFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVG
FT                   VNVPVVVRLEGNNAELGAKKLADSGLNIIAAKGLTDAAQQVVAAVEGK"
     atgaacttac atgaatatca ggcaaaacaa ctttttgccc gctatggctt accagcaccg        60
     gtgggttatg cctgtactac tccgcgcgaa gcagaagaag ccgcttcaaa aatcggtgcc       120
     ggtccgtggg tagtgaaatg tcaggttcac gctggtggcc gcggtaaagc gggcggtgtg       180
     aaagttgtaa acagcaaaga agacatccgt gcttttgcag aaaactggct gggcaagcgt       240
     ctggtaacgt atcaaacaga tgccaatggc caaccggtta accagattct ggttgaagca       300
     gcgaccgata tcgctaaaga gctgtatctc ggtgccgttg ttgaccgtag ttcccgtcgc       360
     gtggtcttta tggcctccac cgaaggcggc gtggaaatcg aaaaagtggc ggaagaaact       420
     ccgcacctga tccacaaagt tgcgcttgat ccgctgactg gcccgatgcc gtatcaggga       480
     cgcgaactgg cgtttaaact gggtctggaa ggtaaactgg ttcagcagtt caccaaaatc       540
     ttcatgggcc tggcgaccat tttcctggag cgcgaccttg cgcttatcga aatcaacccg       600
     ctggttatta ccaaacaggg cgatctggtt tgcctcgacg gcaaactggg tgctgatggc       660
     aacgcactgt tccgccagcc tgatctgcgt gaaatgcgtg accagtcgca ggaagatccg       720
     cgtgaagcac aagctgcaca gtgggaactg aactacgttg cgctggacgg taacatcggt       780
     tgtatggtta acggcgcagg tctggcgatg ggtacgatgg acatcgttaa actgcacggc       840
     ggcgaaccgg ctaacttcct ggacgttggc ggcggcgcaa ccaaagaacg tgtaaccgaa       900
     gcgttcaaaa tcatcctctc tgacgacaaa gtgaaagccg ttctggttaa catcttcggc       960
     ggtatcgttc gttgcgacct gatcgctgac ggtatcatcg gcgcggtagc agaagtgggt      1020
     gttaacgtac cggtcgtggt acgtctggaa ggtaacaacg ccgaacttgg cgcgaagaaa      1080
     ctggctgaca gcggcctgaa tattattgca gcaaaaggtc tgacggatgc agctcagcag      1140
     gttgttgccg cagtggaggg gaaataa                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page