(data stored in ACNUC7421 zone)

EMBL: FM180568.SUCD

FM180568.SUCD        Location/Qualifiers
FT   CDS_pept        678336..679205
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="E2348C_0608"
FT                   /product="succinyl-CoA synthetase, NAD(P)-binding, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08156"
FT                   /db_xref="GOA:B7ULK5"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULK5"
FT                   /protein_id="CAS08156.1"
FT                   /translation="MSILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGG
FT                   TTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLD
FT                   MLIVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVK
FT                   QTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYI
FT                   KEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIG
FT                   EALKTVLQ"
     atgtccattt taattgataa aaacaccaag gttatctgcc agggctttac cggtagccag        60
     gggactttcc actcagaaca ggccattgca tacggcacta aaatggttgg cggcgtaacc       120
     ccaggtaaag gcggtactac ccacctcggc ctgccggtgt tcaacaccgt gcgtgaagct       180
     gttgctgcta ctggcgctac cgcctctgtt atctacgtac cagcaccgtt ctgcaaagac       240
     tccattctgg aagctatcga tgcaggcatc aaactgatta tcaccatcac tgaaggcatc       300
     ccgacgctgg atatgctgat tgtgaaagtg aaactggatg aagcaggcgt tcgtatgatc       360
     ggcccgaact gcccaggcgt tatcaccccg ggggaatgca aaatcggtat ccagccgggt       420
     cacattcaca aaccaggtaa agtgggtatc gtttcccgtt ccggtacgct gacctatgaa       480
     gcggttaaac agaccacgga ttacggtttc ggtcagtcga cctgtgttgg tatcggcggc       540
     gacccgatcc ctggctctaa ctttatcgac atcctcgaaa tgttcgaaaa agatccgcag       600
     accgaagcga tcgtgatgat cggtgagatc ggcggtagcg ctgaagaaga agcagcggcg       660
     tacatcaagg agcacgttac caagccagtt gtgggttaca tcgctggtgt gactgcgccg       720
     aaaggcaaac gtatgggtca cgcaggtgcg atcattgccg gtggtaaagg gactgcggat       780
     gagaaattcg cagctctgga agccgcaggc gtgaaaaccg ttcgcagcct ggcggatatc       840
     ggtgaagcac tgaaaactgt tctgcaataa                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page