(data stored in ACNUC7421 zone)

EMBL: FM180568.TAUA

FM180568.TAUA        Location/Qualifiers
FT   CDS_pept        345698..346660
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="E2348C_0305"
FT                   /product="taurine transporter subunit TauA"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07853"
FT                   /db_xref="GOA:B7UJJ5"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJJ5"
FT                   /protein_id="CAS07853.1"
FT                   /translation="MAISSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPAKVAQADNTF
FT                   AKESGATVDWRKFDSGASIVRALASGDVQIGNLGSSPLAVATSQQVPIEVFLLASKLGN
FT                   SEALVVKKTISKPEDLIGKRIAVPFISTTHYSLLAALKHWGIKPGQVEIVNLQPPAIIA
FT                   AWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDFAEKHPEVVK
FT                   AFAKSAIDAQQPYIANPEAWLKQPENISKLARLSGVPEGDVPGLVKGNTYLTPKQQTAE
FT                   LTGPVNKAIIDTAQFLKEQGKVPAVANDYSQYVTSRFVQ"
     atggcaattt catcgcgtaa cacacttctt gccgcactgg cattcatcgc ttttcaggcg        60
     caggcggtga acgtcaccgt ggcgtatcaa acctccgccg aaccggcgaa agtggctcag       120
     gccgacaaca cctttgctaa agaaagcgga gcaaccgtgg actggcgtaa gtttgacagt       180
     ggagccagca tcgtgcgggc gctggcttcg ggcgatgtgc aaatcggcaa cctcggttcc       240
     agcccgttag cggttgcaac cagccaacag gtgccgattg aagtcttctt gctggcgtca       300
     aaactgggta actccgaagc gctggtggta aagaaaacta tcagtaaacc ggaagacttg       360
     attggtaaac gcatcgccgt accgtttatc tccaccaccc actacagcct gctggcggcg       420
     ctgaaacact ggggtattaa acctgggcaa gttgagattg tgaacctgca gccgcccgca       480
     attatcgccg catggcagcg gggagatatt gatggtgctt atgtctgggc accggcggtt       540
     aacgccctgg aaaaagatgg caaggtgctg accgattctg aacaggtcgg gcagtggggc       600
     gcgccgacac tggacgtatg ggtcgtgcgg aaagattttg ctgagaaaca tcctgaggtc       660
     gtgaaagcgt tcgctaaaag cgccatcgat gctcagcaac cgtacattgc taacccagag       720
     gcgtggctga aacagccgga aaacatcagc aaactggcgc ggttaagcgg cgtgccggaa       780
     ggtgacgttc cggggctggt gaaggggaat acctatctga cgccgaagca acaaacggca       840
     gaactgaccg gaccggtgaa caaagcgatc atcgacaccg cgcagttttt gaaagagcag       900
     ggcaaagtcc cggctgtagc gaatgattac agccagtacg ttacctcgcg cttcgtgcaa       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page