(data stored in ACNUC7421 zone)

EMBL: FM180568.TAUB

FM180568.TAUB        Location/Qualifiers
FT   CDS_pept        346673..347440
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="E2348C_0306"
FT                   /product="taurine transporter subunit TauB"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07854"
FT                   /db_xref="GOA:B7UJJ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJJ6"
FT                   /protein_id="CAS07854.1"
FT                   /translation="MLQISHLYADYGGKPALEDINLTLESGELLVVLGPSGCGKTTLLN
FT                   LIAGFVPYQHGSIQLAGKGIQGPGAERGVVFQNEGLLPWRNVKDNVAFGLQLAGVEKMQ
FT                   RLEIAHQMVKKVGLEGAEKRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFT
FT                   RDQMQTLLLKLWQETGKQVLLITHDIEEAVFMATELVLLSSGPGRVLERLQLNFARRFV
FT                   AGESSRSIKSDPQFIAMREYVLSRVFEQREAFS"
     atgctgcaaa tttctcatct ttacgccgat tatggcggca aaccggcact ggaagatatc        60
     aacctgacgc tggaaagcgg cgagcttctg gtagttctgg ggccgtctgg ctgcggcaaa       120
     actacgttgt tgaatttgat tgctggtttt gtgccttatc agcatggcag cattcaactg       180
     gcgggtaagg gtattcaggg accgggagca gagcgtggcg tagtttttca gaatgaaggg       240
     ctgttaccgt ggcgcaatgt aaaggacaac gtggcgttcg gcctgcaact ggcaggtgta       300
     gagaaaatgc agcgactgga aatcgcacac cagatggtga aaaaagtcgg gctggaaggc       360
     gcagaaaaac gctacatctg gcagctttcc ggtggtcaac gtcagcgggt ggggattgcc       420
     cgcgcgttgg cggcaaatcc ccagctgtta ttactcgacg aaccgtttgg tgcgctggac       480
     gcctttaccc gcgaccagat gcaaaccctg ctgctgaaac tctggcagga gacgggcaag       540
     caggtgctgt tgattaccca cgatatagaa gaagcggtgt ttatggcgac tgaactggtt       600
     ctgctttcat ccggtcctgg ccgtgtgctg gagcggctgc agctcaactt tgctcgccgc       660
     tttgttgcgg gagagtcgag ccgcagcatc aagtccgatc cacaattcat cgccatgcgc       720
     gaatatgttt taagccgcgt atttgagcag cgggaggcgt tctcatga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page