(data stored in ACNUC7421 zone)

EMBL: FM180568.TBPA

FM180568.TBPA        Location/Qualifiers
FT   CDS_pept        complement(81836..82819)
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="E2348C_0074"
FT                   /product="thiamin transporter subunit TbpA"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07622"
FT                   /db_xref="GOA:B7UIB9"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIB9"
FT                   /protein_id="CAS07622.1"
FT                   /translation="MLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPVVKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAAE
FT                   AVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYEDPRTSTP
FT                   GLGLLLWMQKVYGDNAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   ILEEKKDNYAATNFSEGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWM
FT                   YPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAWISEWQRAVSR"
     gtgttaaaaa aatgtcttcc cctgctgttg ctgtgcacag cgcctgtttt cgctaaacct        60
     gttctgactg tttataccta cgattccttt gccgctgact ggggacctgg tccggtagtc       120
     aaaaaagcct ttgaagcaga ctgtaattgc gaactgaaac tggtggcgct ggaagatggc       180
     gtttcgctgc tcaaccgtct acggatggaa ggcaaaaaca gcaaagccga tgtggtgctg       240
     gggctggata acaatctgtt agacgccgcc agcaaaacag ggctgtttgc taaaagcggt       300
     gtggcagcgg aagccgttaa cgttcctggc ggctggaata atgacacttt cgtaccgttt       360
     gattacggct atttcgcctt cgtctatgac aagaacaaac tgaaaaatcc gccgcaaagc       420
     ctgaaagaac tggttgagag cgatcagaac tggcgggtga tttatgaaga tccacgtacc       480
     agtacgccgg ggctgggtct gttgctatgg atgcaaaaag tctatggcga taacgccccg       540
     caagcctggc agaaactggc gaagaaaact gtcacggtca ccaaaggctg gagcgaagcc       600
     tacggcctgt ttttaaaagg cgaaagcgat ctggtactga gttacaccac ctctccggct       660
     tatcacattc tcgaagagaa gaaagataac tacgccgcca caaactttag cgaaggtcac       720
     tatctgcagg tggaagttgc cgcccgcacc gctgccagca agcagccaga gctggcgcaa       780
     aaattcctcc agtttatggt ttctccggct tttcagaatg cgatcccaac cggcaactgg       840
     atgtatccgg tagcaaacgt cactctgcct gcaggatttg aacaattgac caaaccagcc       900
     accacgctag agttcacacc cgccgaagtg gcggcacaac gtcaggcatg gattagcgaa       960
     tggcaacgcg ccgtcagccg ttaa                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page