(data stored in ACNUC7421 zone)

EMBL: FM180568.THIQ

FM180568.THIQ        Location/Qualifiers
FT   CDS_pept        complement(79568..80266)
FT                   /transl_table=11
FT                   /gene="thiQ"
FT                   /locus_tag="E2348C_0072"
FT                   /product="thiamin transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07620"
FT                   /db_xref="GOA:B7UIB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIB7"
FT                   /protein_id="CAS07620.1"
FT                   /translation="MLKLTDITWLYHHLPMRFSLTVERGEQVAILGPSGAGKSTLLNLI
FT                   AGFLTPASGSLTIDGVDHTTTPPSRRPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNA
FT                   AQQKKMHAIAHQMGIDNLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPA
FT                   LRQEMLTLVSSSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAWQGKTDELLSGKA
FT                   SASALLGIKG"
     atgttaaaac tgactgatat cacctggctt taccaccatt tgccgatgcg ttttagctta        60
     acggtggaac gcggcgagca ggtggctatc ctcgggccaa gcggcgcggg taaaagtacc       120
     ctgcttaatt tgatcgccgg ttttctgacg ccagccagcg gttcgctgac tatcgacggc       180
     gtagatcaca ccacgacgcc gccgtcacgc cgtccggtgt ctatgctgtt tcaggagaac       240
     aacctgttca gccacctgac ggtcgcgcaa aacatcgggc tggggctaaa tccggggttg       300
     aaactaaatg ctgcgcagca gaagaaaatg cacgcgattg cccaccagat ggggattgat       360
     aatttaatgg cgcggttacc tggcgagctt tccggcggtc agcgacagcg cgtagcgtta       420
     gcgcgttgtc tggtacgcga acagcccatt ttattgctcg atgaaccgtt ttccgcgctc       480
     gatccggcgc tacgtcagga gatgctgacg ctggtgagtt cgagctgcca acagcaaaaa       540
     atgacgctct tgatggtgtc gcacagtgtg gaagatgcgg cgcggatcgc cacgcgctcg       600
     gtggtggtcg ccgacgggcg tatcgcctgg cagggtaaga ccgatgagtt gttgagcggt       660
     aaggcgagtg cttcggcgct gttgggaatt aaaggttaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page