(data stored in ACNUC7421 zone)

EMBL: FM180568.THRB

FM180568.THRB        Location/Qualifiers
FT   CDS_pept        2800..3732
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="E2348C_0003"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07551"
FT                   /db_xref="GOA:B7UI48"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UI48"
FT                   /protein_id="CAS07551.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVEAAETFS
FT                   LNNLGRFADKLPSEPRENIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALMAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELA
FT                   AKLMKDVIAEPYRERLLPGFRQARQAVAEIGAVASGISGSGPTLFALCDKPDTAQRVAD
FT                   WLGKNYLQNQEGFVHICRLDTAGARVLEN"
     atggttaaag tttatgcccc ggcttccagt gccaatatga gcgtcgggtt tgatgtgctc        60
     ggggcggcgg tgacacctgt tgatggtgca ttgctcggag atgtagtcac ggttgaggca       120
     gcagagacat tcagtctcaa caacctcgga cgctttgccg ataagctgcc gtcagagcca       180
     cgggaaaata tcgtttatca gtgctgggag cgtttttgcc aggagcttgg caagcaaatt       240
     ccagtggcga tgactctgga aaagaatatg ccgatcggtt cgggcttagg ctccagcgcc       300
     tgttcagtgg tcgcggcgct gatggcgatg aatgaacact gcggcaagcc gcttaatgac       360
     actcgtttgc tggctttgat gggtgagctg gaagggcgta tctccggcag cattcattac       420
     gacaacgtgg caccgtgttt tcttggtggt atgcagttga tgattgaaga aaacgacatc       480
     atcagtcagc aagtgccagg gtttgatgag tggctgtggg tgctggcgta tccggggatt       540
     aaagtctcga cggcagaagc ccgggctatt ttaccggcgc agtatcgccg ccaggattgc       600
     attgcgcacg ggcgacatct ggcaggcttt attcacgcct gctattcccg tcagcctgag       660
     cttgccgcga agctgatgaa agatgttatc gctgaaccct accgtgaacg gttactgcca       720
     ggcttccggc aggcgcggca ggcggtcgcg gaaatcggcg cggtagcgag cggtatctcc       780
     ggctccggcc cgactttgtt cgctctgtgt gacaagccgg ataccgccca gcgcgttgcc       840
     gactggttgg gtaagaacta cctgcaaaat caggaaggtt ttgttcatat ttgccggctg       900
     gatacggcgg gcgcacgagt actggaaaac taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page