(data stored in ACNUC7421 zone)

EMBL: FM180568.TOLA

FM180568.TOLA        Location/Qualifiers
FT   CDS_pept        690275..691477
FT                   /transl_table=11
FT                   /gene="tolA"
FT                   /locus_tag="E2348C_0623"
FT                   /product="membrane anchored protein TolA in TolA-TolQ-TolR
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08171"
FT                   /db_xref="GOA:B7ULL9"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULL9"
FT                   /protein_id="CAS08171.1"
FT                   /translation="MSKATEQNDKLKRAIIISAVLHVILFAALIWSSFDENIEASAGGG
FT                   GGSSIDAVMVDSGAVVEQYKRMQSQESSAKRSDEQRKMKEQQAAEELREKQAAEQERLK
FT                   QLEKERLAAQEQKKQAEEAAKQAELKQKQAEEAAAKAAADAKAKAEADAKAAEEAAKKA
FT                   AADAKKKAEAEAAKAAVEAQKKAEAAAAALKKKAEAAEAAAAEARKKAATEAAEKAKAE
FT                   AEKKAAAEKAAAEKAAADKKAAAEKAAADKKAAAAKAAAEKAAAAKAAAEADDIFGELS
FT                   SGKNAPKTGGGAKGNNASPAGSGNTKNNGASGADINNYAGQIKSAIESKFYDASSYAGK
FT                   TCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAKIPKPPSQAVYEVFKNAPLDFK
FT                   P"
     gtgtcaaagg caaccgaaca aaacgacaag ctcaagcggg cgataattat ttcagcagtg        60
     ctgcatgtca tcttatttgc ggcgctgatc tggagttcgt tcgatgagaa tatagaagct       120
     tcagccggag gcggcggtgg ttcgtccatc gacgctgtca tggttgattc aggtgcggta       180
     gttgagcagt acaaacgcat gcaaagccag gaatcaagcg cgaagcgttc tgatgagcag       240
     cgcaagatga aagagcagca ggctgctgaa gaactgcgtg agaaacaagc ggctgaacag       300
     gaacgcctga agcaacttga gaaagagcgg ttagcggctc aggagcagaa aaagcaggct       360
     gaagaagccg caaaacaggc cgagttaaag cagaagcaag cggaagaggc ggcagcgaaa       420
     gcggcggcag atgctaaagc gaaggccgaa gcggatgcta aagctgcgga agaagcagcg       480
     aagaaagcgg cggcagacgc gaagaaaaaa gcagaagcag aagccgccaa agccgcagtc       540
     gaagcgcaga aaaaagccga ggctgctgcg gcggcgctga agaagaaagc tgaagcggca       600
     gaagcagctg cagctgaagc aagaaagaaa gcggcaaccg aagctgctga aaaagccaag       660
     gcagaagctg agaagaaagc ggctgctgaa aaggctgcag ctgaaaaggc agcagctgat       720
     aagaaagcag cggcagaaaa agccgccgca gacaaaaaag cggcagcggc aaaagcagca       780
     gctgaaaaag ccgctgcagc aaaagctgcc gcagaggcag atgatatttt cggtgagcta       840
     agctctggta agaatgcacc gaaaacgggg ggaggggcga aagggaacaa tgcttcgcct       900
     gccgggagtg gtaatactaa aaacaatggc gcatcagggg ccgatatcaa taactatgcc       960
     gggcagatta aatctgctat cgaaagtaag ttctatgacg catcgtccta tgcaggcaaa      1020
     acctgtacgc tgcgcataaa actggcaccc gatggtatgt tactggatat caaacctgaa      1080
     ggtggcgatc ccgcactttg tcaagctgcg ttggcagcag ctaaacttgc gaagatcccg      1140
     aaaccaccaa gccaggcagt atatgaagtg ttcaaaaacg cgccattgga cttcaaaccg      1200
     taa                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page