(data stored in ACNUC7421 zone)

EMBL: FM180568.TOLQ

FM180568.TOLQ        Location/Qualifiers
FT   CDS_pept        689086..689778
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="E2348C_0621"
FT                   /product="membrane spanning protein TolQ in TolA-TolQ-TolR
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08169"
FT                   /db_xref="GOA:B7ULL7"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULL7"
FT                   /protein_id="CAS08169.1"
FT                   /translation="MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAA
FT                   AREAEAFEDKFWSGIELSRLYQESQGKRDNLSGSEQIFYSGFKEFVRLHRANSHAPEAV
FT                   VEGASRAMRISMNRELENLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQAT
FT                   LQMVAPGIAEALIATAIGLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQAF
FT                   TVSESNKG"
     gtgactgaca tgaatatcct tgatttgttc ctgaaggcta gccttctggt taaacttatc        60
     atgttgattt tgattggttt ttcaatcgca tcctgggcca ttattatcca gcggacccgt       120
     attcttaacg cagcggcgcg cgaagccgaa gcgtttgaag ataaattctg gtctggaatc       180
     gaactctctc gcctctatca agagagccag gggaaacggg ataatctgag cggttcggaa       240
     caaatctttt acagcggatt caaagagttt gtgcgcctgc atcgtgccaa tagccatgcg       300
     ccggaagccg tagtggaagg ggcgtcgcgt gcgatgcgta tttccatgaa ccgtgaactt       360
     gaaaatctgg aaacgcacat tccgttcctc ggtacggttg gctccatcag cccgtatatt       420
     ggtctgtttg gtacggtctg ggggatcatg cacgccttta tcgccctcgg ggcggtaaaa       480
     caagcaacac tgcaaatggt tgcgcccggt atcgcagaag cgttgattgc gacggcaatt       540
     ggtttgttcg ccgcaattcc ggcggtaatg gcttataacc gcctcaacca gcgcgtaaac       600
     aaactggaac tgaattacga caactttatg gaagagttta ccgcgattct gcaccgccag       660
     gcgtttaccg ttagcgagag caacaagggg taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page