(data stored in ACNUC7421 zone)

EMBL: FM180568.TOLR

FM180568.TOLR        Location/Qualifiers
FT   CDS_pept        689782..690210
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="E2348C_0622"
FT                   /product="membrane spanning protein TolR in TolA-TolQ-TolR
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08170"
FT                   /db_xref="GOA:B7ULL8"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULL8"
FT                   /protein_id="CAS08170.1"
FT                   /translation="MARARGRGRRDLKSEINIVPLLDVLLVLLLIFMATAPIITQSVEV
FT                   DLPDATESQAVSSNDNPPVIVEVSGIGQYTVVVEKDRLERLPPEQVVAEVSSRFKANPK
FT                   TVFLIGGAKDVPYDEIIKALNLLHSAGVKSVGLMTQPI"
     atggccagag cgcgtggacg aggtcgtcgc gatctcaagt ccgaaatcaa cattgtaccg        60
     ttgctggacg tactgctggt gctgttgctg atctttatgg cgacagcgcc catcatcacc       120
     cagagcgtgg aggtcgatct gccagacgct actgaatcac aggcggtgag cagtaatgat       180
     aatccgccag tgattgttga agtgtctggt attggtcagt acaccgtggt ggttgagaaa       240
     gatcgcctgg agcgtttacc accagagcag gtggtggcgg aagtgtccag ccgtttcaag       300
     gccaacccga aaacggtctt tctgattggt ggcgcaaaag atgtgcctta cgatgaaata       360
     attaaagcac tgaacttgtt acatagtgcg ggtgtgaaat cggttggttt aatgacgcag       420
     cctatctaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page