(data stored in ACNUC7421 zone)

EMBL: FM180568.TSF

FM180568.TSF         Location/Qualifiers
FT   CDS_pept        200863..201714
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="E2348C_0175"
FT                   /product="protein chain elongation factor EF-Ts"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07723"
FT                   /db_xref="GOA:B7UIL5"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UIL5"
FT                   /protein_id="CAS07723.1"
FT                   /translation="MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSG
FT                   AIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGK
FT                   ITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADE
FT                   ELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKK
FT                   FTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSK
FT                   QS"
     atggctgaaa ttaccgcatc cctggtaaaa gagctgcgtg agcgtactgg cgcaggcatg        60
     atggattgca aaaaagcact gactgaagct aacggcgaca tcgagctggc aatcgaaaac       120
     atgcgtaagt ccggtgctat taaagcagcg aaaaaagcag gcaacgttgc tgctgacggc       180
     gtgatcaaaa ccaaaatcga cggcaactac ggcatcattc tggaagttaa ctgccagact       240
     gacttcgttg caaaagacgc tggtttccag gcgttcgcag acaaagttct ggacgcagct       300
     gttgctggca aaattactga cgttgaagtt ttgaaagcac agttcgaaga agaacgtgtt       360
     gcgctggtag cgaaaattgg tgaaaacatc aacattcgcc gcgttgctgc gctggaaggc       420
     gacgttctgg gttcttatca gcacggtgcg cgtatcggtg ttctggttgc tgctaaaggc       480
     gctgacgaag agctggttaa acacatcgct atgcacgttg ctgcaagcaa gccagaattc       540
     atcaaaccag aagacgtatc cgctgaagtg gtagaaaaag aataccaggt acagctggat       600
     atcgcgatgc agtctggtaa gccgaaagaa atcgcagaga aaatggttga aggccgcatg       660
     aagaaattca ccggcgaagt ttctctgacc ggtcagccgt tcgttatgga accaagcaaa       720
     actgttggtc agctgctgaa agagcataac gctgaagtga ctggcttcat ccgcttcgaa       780
     gtgggtgaag gcatcgagaa agttgagact gactttgcag cagaagttgc tgcgatgtcc       840
     aagcagtctt aa                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page