(data stored in ACNUC7421 zone)

EMBL: FM180568.TSX

FM180568.TSX         Location/Qualifiers
FT   CDS_pept        complement(390158..391042)
FT                   /transl_table=11
FT                   /gene="tsx"
FT                   /locus_tag="E2348C_0346"
FT                   /product="nucleoside channel, receptor of phage T6 and
FT                   colicin K"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07894"
FT                   /db_xref="GOA:B7UJN4"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJN4"
FT                   /protein_id="CAS07894.1"
FT                   /translation="MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSDWWHQSVNVVGSY
FT                   HTRFGPQIRNDTYLEYEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEP
FT                   RFSIDKLTNTDLSFGPFKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSM
FT                   NVYAKYQWQNYGAANENEWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSG
FT                   NAINGIKTRTNNSIASSHILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRS
FT                   TGWGGYLVVGYNF"
     atgaaaaaaa cattactggc agccggtgcg gtactggcgc tctcttcgtc ttttactgtc        60
     aacgcagctg aaaacgacaa accgcagtat ctttccgact ggtggcacca gagcgttaac       120
     gttgtcggaa gctatcacac ccgtttcgga ccgcagatcc gcaacgatac ctaccttgag       180
     tacgaagcat tcgctaaaaa agactggttc gacttctatg gttatgcgga tgcgccggta       240
     ttcttcggcg gtaactccga tgcaaaaggt atctggaacc acggttctcc gctgtttatg       300
     gaaatcgaac cacgtttctc catcgacaag ctgaccaata ctgaccttag ctttggtccg       360
     ttcaaagagt ggtacttcgc gaacaactac atttacgaca tgggtcgtaa taaagatggt       420
     cgccagagca cctggtacat gggtctgggt accgatatcg atactggcct gccgatgagc       480
     ctgtccatga acgtctatgc gaaataccag tggcagaact atggcgcagc gaatgaaaac       540
     gagtgggacg gttaccgttt caaaattaaa tactttgtgc cgattaccga tctgtggggc       600
     ggtcagctga gctacatcgg cttcaccaac ttcgactggg gttccgattt aggggatgac       660
     agcggtaatg caatcaacgg tattaagacc cgtaccaata actccatcgc ttccagccat       720
     attctggctc tgaactacga tcactggcac tactctgtcg tagctcgtta ctggcacgac       780
     ggtggtcagt ggaacgacga tgcagaactg aacttcggca acggcaactt caacgttcgc       840
     tctaccggct ggggtggtta cctggtagta ggttacaact tctaa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page