(data stored in ACNUC7421 zone)

EMBL: FM180568.YAAA

FM180568.YAAA        Location/Qualifiers
FT   CDS_pept        complement(5579..6355)
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="E2348C_0006"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07554"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UI51"
FT                   /protein_id="CAS07554.1"
FT                   /translation="MLILISPAKTLDYQSPLTTTRYTLPELLDNAQQLIHEARKLTPPQ
FT                   ISSLMRISDKLAGINAARFHDWQPDFTPENARQAILAFKGDVYTGLQAETFSEDDFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENARGKDLYQFWGDIITNKLNEALAAQG
FT                   DNVVINLASDEYFKSVKPKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIEN
FT                   RLTKPEQLTGFNSEGYFFDEASSSNGELVFKRYEQR"
     atgctgattc ttatttcacc tgcgaaaacg cttgattacc aaagcccgtt gaccaccacg        60
     cgctatacgc tgccggagct gttagacaac gcccagcagc tgatccatga agcgcggaaa       120
     ctgacgcccc cgcagattag ctccctgatg cgcatcagcg acaaactggc gggtatcaat       180
     gccgctcgct ttcatgactg gcagccagat ttcacaccgg agaatgcccg ccaggcaatt       240
     ctggcgttta aaggtgatgt ctacactggc ttgcaggccg aaaccttcag cgaagacgat       300
     ttcgattttg cccaacagca tttgcgaatg ctttccggct tgtatggcgt actgcgcccg       360
     ctcgatttaa tgcagcctta tcgtctggaa atggggatac gtcttgagaa tgcccgaggg       420
     aaagatctgt atcaattctg gggagatatc atcaccaaca agctgaacga ggcgctcgca       480
     gcacaaggcg ataatgtagt gataaatctg gcgtcagatg agtattttaa atcggtgaag       540
     ccgaagaaat tgaatgccga gattatcaag ccagtgttcc tcgatgagaa gaacggcaaa       600
     tttaagataa tcagcttcta cgctaagaaa gcacgcggtc tgatgagtcg tttcattatt       660
     gaaaatcggc tgaccaaacc agagcaactg actggtttta atagcgaagg ttacttcttt       720
     gatgaagctt cctccagcaa tggcgaactg gtgtttaaac gctacgaaca acgttaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page