(data stored in ACNUC7421 zone)

EMBL: FM180568.YAAI

FM180568.YAAI        Location/Qualifiers
FT   CDS_pept        complement(12836..13240)
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="E2348C_0013"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07561"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UI58"
FT                   /protein_id="CAS07561.1"
FT                   /translation="MKSVITISASLAISLMLCCTAQANDHKILGVIAMPRNETNDLALK
FT                   LPVCRIVKRIQLSTDHGDLQLSGASVYFKATRSASQTLNIPSEIKEGQTTDWININSDN
FT                   DNKRCVSKITFSGHTVNSSDMATLKIIGDD"
     atgaaatccg ttattacgat ttccgccagc ctggcgatta gcctgatgct gtgctgcacg        60
     gcgcaggcaa acgaccataa aatcctcggc gtcattgcaa tgccgcgaaa cgaaaccaac       120
     gatctagcgc tgaaacttcc tgtttgtcgc attgttaaac gcatacagct ctcaaccgac       180
     catggcgatt tgcagttaag cggtgcatcg gtttatttca aagccacccg tagcgccagt       240
     cagaccctga atattccttc agaaataaaa gaagggcaaa ccactgactg gatcaacatt       300
     aacagcgata acgacaacaa acgctgcgtc tcaaaaatca ccttttccgg tcatacagtg       360
     aactcatctg atatggccac gctgaaaatt atcggcgacg actaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page