(data stored in ACNUC7421 zone)

EMBL: FM180568.YAAW

FM180568.YAAW        Location/Qualifiers
FT   CDS_pept        complement(12097..12810)
FT                   /transl_table=11
FT                   /gene="yaaW"
FT                   /locus_tag="E2348C_0012"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07560"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="InterPro:IPR025217"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI57"
FT                   /protein_id="CAS07560.1"
FT                   /translation="MNVNYLNDSDLDFLQHCSEEQLANFARLLTHNEKGKTRLSSVLMR
FT                   NELFKSMEGHPERYRRNWQLIAGELQHFGGDSIANKLRGHGKLYRAILLDVSKRLKLKA
FT                   DKEMSTFEIEQQLLEQFLRNTWKKMDEEHKQEFLHAVDARVNELEELLPLLMKDKLLAK
FT                   GVSHLLSSQLTRILRTHAAMSVLGHGLLRGAGLGGPVGAALNGVKAVSGSAYRVTIPAV
FT                   LQIACLRRMVSATQV"
     atgaatgtta attacctgaa tgattcagat ctggattttc tccagcattg tagtgaagaa        60
     cagttggcaa atttcgcccg gctgctcacc cataatgaaa aaggcaaaac tcgcctctcc       120
     agcgtactga tgcgcaacga actgtttaaa tcgatggaag gacatcccga gcgataccgc       180
     cgcaactggc agctgattgc cggagaatta cagcattttg gtggcgatag tatcgccaac       240
     aaactgcgcg gacacggtaa attgtatcgc gccattttgc tcgatgtttc aaagcgattg       300
     aagctgaaag ccgacaaaga gatgtctacg tttgaaattg agcaacagtt actggaacaa       360
     tttctgcgta atacctggaa gaaaatggac gaggaacata agcaggagtt tctgcacgcg       420
     gtcgatgcca gggtgaatga gctggaagag ctgctgccgc tgctgatgaa agacaaatta       480
     ttggcaaaag gtgtgtcgca tttgctttcc agccaattga cccgcatttt acgcacccac       540
     gcagcaatga gcgtgcttgg gcatggtttg ctgcgcggcg cgggtctggg aggccctgtg       600
     ggcgcagcat taaatggggt taaagcggtc agcggcagtg cctatcgcgt gacaattcca       660
     gccgtactgc aaatcgcttg cctgcgccgg atggttagcg ccactcaggt ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page