(data stored in ACNUC7421 zone)

EMBL: FM180568.YAAX

FM180568.YAAX        Location/Qualifiers
FT   CDS_pept        5233..5529
FT                   /transl_table=11
FT                   /gene="yaaX"
FT                   /locus_tag="E2348C_0005"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07553"
FT                   /db_xref="InterPro:IPR019638"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI50"
FT                   /protein_id="CAS07553.1"
FT                   /translation="MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYY
FT                   WDGGHWRDHGWWKQHYEWRGNRWHPHGPPPSPRHNKHNDHRGDHRPGPDKHHR"
     gtgaaaaaga tgcaatctat cgtactcgca ctttccctgg ttctggtcgc tcccatggca        60
     gcgcaggctg cggaaattac gctagtcccg tcagtaaaat tacagatagg cgatcgtgat       120
     aatcgtggct attactggga tggcggtcac tggcgcgacc acggctggtg gaaacaacat       180
     tatgaatggc gaggcaatcg ctggcaccca catggaccgc cgccatcgcc gcgccataac       240
     aagcacaatg atcatcgtgg cgatcatcgt ccggggcctg acaaacatca tcgctaa          297
//

If you have problems or comments...

PBIL Back to PBIL home page