(data stored in ACNUC7421 zone)

EMBL: FM180568.YABI

FM180568.YABI        Location/Qualifiers
FT   CDS_pept        78690..79454
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="E2348C_0071"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07619"
FT                   /db_xref="GOA:B7UIB6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIB6"
FT                   /protein_id="CAS07619.1"
FT                   /translation="MQALLEHFITQSTVYSLMAVVLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELSFWYAWLAGIIGCLMGDWISFWLGWRFKKPLHRWSFLKKNKALLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPGILAG
FT                   AAIDIPAGMQSGEFKWLLLVTAVLLWVGGWLCWRLWRSGKATDRLSHYLSRGRLLWLTP
FT                   LISAIGVVALVVLIRHPLMPVYIDILRKVVGV"
     atgcaagcat tgctggaaca ctttattacc caatccaccg tgtattcatt gatggcggtg        60
     gtgttggtgg cctttctgga gtcgctggcg ctggtcggtt tgattctacc cggtacggtg       120
     ctgatggcgg ggctgggagc gctgattggt agcggtgagt taagtttctg gtacgcctgg       180
     ctggcgggga ttattggctg cctgatgggc gactggatct ccttctggct gggctggcgt       240
     tttaaaaagc cgttgcatcg ctggtcattt ctgaagaaga acaaagcatt actcgataaa       300
     accgaacatg cgctgcatca gcacagcatg ttcaccattc tggtcggtcg ttttgtcggt       360
     ccgacgcgtc cgctggtgcc aatggtggcg ggaatgctgg atctgccggt ggcgaaattt       420
     attacgccaa atattatcgg ctgcctgtta tggccaccgt tttacttcct gccggggatt       480
     ctggcgggtg cggcgatcga tattcctgcc gggatgcaga gcggtgagtt taaatggttg       540
     ctgctggtga cggcggtatt gttgtgggtt ggtggctggc tgtgctggcg gttatggcgc       600
     agcggtaaag cgactgaccg tttgagtcat tatttgtccc gcggtcgttt gttgtggctg       660
     acgccgttga tttctgccat cggcgtggtg gcgctggtgg tgttaattcg ccacccgttg       720
     atgccggtgt atatcgatat tttgcgtaaa gtggttgggg tttag                       765
//

If you have problems or comments...

PBIL Back to PBIL home page