(data stored in ACNUC7421 zone)

EMBL: FM180568.YACC

FM180568.YACC        Location/Qualifiers
FT   CDS_pept        complement(142451..142798)
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="E2348C_0125"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07673"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIH0"
FT                   /protein_id="CAS07673.1"
FT                   /translation="MKTFFRTVLFGSLMAVCANSYALSESEAEDMADLTAVFVFLKNDC
FT                   GYQNLPNGQIRRALVFFAQQNQWDLSNYDTFDMKALGEDSYRDLSGIGIPVAKKCKALA
FT                   RDSLSLLAYVK"
     atgaagacgt ttttcagaac agtgttattc ggcagcctga tggccgtttg cgcaaacagt        60
     tacgcgctca gcgagtctga agccgaagat atggccgatt taacggcagt ttttgttttt       120
     ctgaagaacg attgtggtta ccagaactta cctaacgggc aaattcgtcg cgcgctggtc       180
     tttttcgccc agcaaaacca gtgggatctc agtaattacg acaccttcga catgaaagcc       240
     ctcggtgaag acagctaccg cgatctcagt ggcattggca ttcccgtcgc taaaaagtgc       300
     aaagccctgg cccgcgattc cttaagcctg cttgcctacg tcaaataa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page