(data stored in ACNUC7421 zone)

EMBL: FM180568.YACH

FM180568.YACH        Location/Qualifiers
FT   CDS_pept        complement(135289..137142)
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="E2348C_0120"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07668"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIG5"
FT                   /protein_id="CAS07668.1"
FT                   /translation="MKMTLPFKPHVLALICSAGLCAASAGLYIKSRTVEAPVEAQSTQQ
FT                   TAPDISAVTLPATVSAPPVTPAVVKSTFSTAQIDQWVAPVALYPDSLLSQVLMASTYPA
FT                   NVAQAVQWSHDNPLKQGDAAIQAVSGQSWDASVKSLVAFPQLMALMGENPQWVQNLGDA
FT                   FLAQPQDVMDSVQRLRQLAQQTGSLKSSTEQKIITTTKKVVPVNQPANAPATQSNTVST
FT                   SSPVVAEPAPTVITIEPANPDVVYIPNYNPNVVYGSWANTAYPPVYLPPPAGEPFVDSF
FT                   VRGFGYSMGVATTYALFSSIDWDDDDHDHHHHDDDDYHHHDGGHRDGNDWQHNGDNINI
FT                   DVNNFNRITGEHLTDKNMAWQHNPNYRNGVPYHDQDMAKRFHQTDVNGGMSATQLPAPT
FT                   RDSQRHAAASQFQQRTHTAPVITRDTQRQAAAQRFNEAEHNGSYDDFRDFSRRQPLTQQ
FT                   QKDAARQRYQSASPEQRQAAREKMQTNPQNQQRREAARQRIQSAPPEQRQAVREKMQTN
FT                   PQNQQRREAARQRIQSASPEQRQVFKEKVQQRPLNQEQRDNARQRVQSASPEQRPFFRE
FT                   KVQESRPQRLNDSNRTARLNNEQRSTVRERLSERGARRLER"
     atgaaaatga ctttgccgtt taaaccccat gtgctggcgc taatttgcag tgcagggctt        60
     tgtgccgcct ctgccgggct atatataaaa agccgcacag tggaagcgcc tgtggaagcg       120
     caatcgacac aacagactgc gcctgacatc tccgcagtta cgcttcctgc aacggtttcc       180
     gcgcctcccg taacgcctgc cgtcgtcaaa tctacattca gcactgcaca aatcgatcaa       240
     tgggtcgcgc ccgtcgcgct gtaccccgac tctctgcttt cacaagtgtt aatggcatca       300
     acctatccgg caaacgttgc gcaagcagtg caatggtcac acgataatcc acttaaacaa       360
     ggcgatgctg ctattcaggc ggtatctggc cagtcctggg acgccagcgt caaatcactg       420
     gtggcctttc cacagttgat ggcgttgatg ggcgaaaacc cgcaatgggt gcaaaacctg       480
     ggcgatgctt ttctggcgca gccgcaggac gtgatggact cggtacagcg attgcggcaa       540
     ctggcgcaac aaaccggctc gctgaagtca tcaactgaac aaaagatcat cacgacaacg       600
     aaaaaagtcg taccggtaaa tcagcccgcc aacgcccctg ccacacaatc aaataccgtt       660
     tctacgtcca gccccgtcgt cgcagaacct gcaccgaccg taataaccat tgagccagcc       720
     aatccggatg tggtttatat tccgaactac aacccaaacg tggtttacgg cagttgggcc       780
     aataccgctt atccgccagt ttatctgccg ccgccagccg gagaaccgtt tgttgacagc       840
     tttgtgcgcg gattcggcta tagcatgggc gttgctacca catacgcact attcagcagc       900
     atcgactggg acgacgacga tcatgaccat catcatcatg acgatgatga ttatcatcac       960
     cacgatggag gtcatcgtga cggtaatgac tggcaacaca acggcgacaa catcaatatc      1020
     gacgtcaaca atttcaaccg tatcaccggt gagcatctta ctgataagaa tatggcatgg      1080
     cagcacaatc caaactaccg taatggtgta ccctatcatg atcaggatat ggcaaagcgg      1140
     tttcatcaaa ccgatgtcaa cggcggaatg agcgccacgc agttacctgc tccaacacgc      1200
     gacagccagc gtcatgcggc agcaagtcag tttcagcaac gaacacacac cgcccccgtc      1260
     attacacgag atacccaacg tcaggcagcg gcacagcggt ttaatgaagc tgaacacaat      1320
     gggagctatg acgacttccg cgacttcagc cgtcgccagc cactgaccca gcaacaaaag      1380
     gacgccgctc gtcagcgtta tcagtcggct tctcctgagc agcgccaggc ggcccgcgag      1440
     aaaatgcaga ctaacccgca gaaccagcag cgaagagaag cggcacgtca gcgtattcag      1500
     tccgcgccgc ctgagcagcg ccaggcggtt cgcgagaaaa tgcagactaa cccgcagaac      1560
     cagcagcgaa gagaggcagc gcgccagcgc attcagtccg catcaccaga gcagcgccag      1620
     gtgtttaagg aaaaagtaca gcagcgccca ctgaaccaag agcaacgtga taacgcccgc      1680
     cagcgtgttc aatcggcatc acctgaacaa cgtccgtttt ttcgggagaa agttcaggag      1740
     agccgcccgc aacgtctaaa cgacagtaac cgtactgccc gattgaataa cgagcagcgg      1800
     tcaacagtac gcgaacgtct ctctgaacgt ggagcaagaa gactggaaag gtaa            1854
//

If you have problems or comments...

PBIL Back to PBIL home page