(data stored in ACNUC7421 zone)

EMBL: FM180568.YACL

FM180568.YACL        Location/Qualifiers
FT   CDS_pept        140269..140631
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="E2348C_0122"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07670"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UIG7"
FT                   /protein_id="CAS07670.1"
FT                   /translation="MDYEFLRDITGVVKVRMSMGHEVVGHWFNEEVKENLALLDEVEQA
FT                   AHALKGSERSWQRAGHEYTLWMDGEEVMVRANQLEFAGDEMEEGMNYYDEESLSLCGVE
FT                   DFLQVVAAYRNFVQQK"
     atggattacg aatttctgcg cgatattacc ggagtggtaa aggtgcgcat gtccatgggg        60
     catgaagtgg tcgggcactg gtttaatgaa gaggtgaaag aaaacctggc cttgcttgat       120
     gaagtggaac aagcggcgca cgcattgaaa ggtagcgaac gttcctggca acgggcaggg       180
     catgaataca cgttgtggat ggacggtgaa gaggtgatgg ttcgcgccaa tcaactggaa       240
     ttcgctggcg atgaaatgga agaggggatg aactactacg atgaagagag cttgtcgctg       300
     tgcggcgttg aggattttct tcaggtggtg gcggcttacc gtaatttcgt gcagcagaag       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page