(data stored in ACNUC7421 zone)

EMBL: FM180568.YADH

FM180568.YADH        Location/Qualifiers
FT   CDS_pept        149428..150198
FT                   /transl_table=11
FT                   /gene="yadH"
FT                   /locus_tag="E2348C_0131"
FT                   /product="predicted transporter subunit: membrane component
FT                   of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07679"
FT                   /db_xref="GOA:B7UIH6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIH6"
FT                   /protein_id="CAS07679.1"
FT                   /translation="MMHLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNL
FT                   IGSRIGDMHGFSYMQFIVPGLIMMSVITNAYANVASSFFGAKFQRNIEELLVAPVPTHV
FT                   IIAGYVGGGVARGLFVGILVTAISLFFVPFQVHSWVFVALTLVLTAVLFSLAGLLNGVF
FT                   AKTFDDISLVPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIN
FT                   DVPLVTTFGVLVVFIVAFYLICWSLIQRGRGLRS"
     atgatgcatc tttactgggt ggcgctaaaa agcatctggg cgaaagagat ccatcgcttt        60
     atgcgtatct gggtgcagac gctggtgccg ccagtcatca ccatgaccct ttactttatt       120
     atcttcggta acctgattgg ttcgcgtatt ggcgatatgc atggcttcag ctacatgcag       180
     ttcatcgtac cggggctgat catgatgtcg gtgatcacca acgcctacgc taacgtcgcg       240
     tcatcatttt ttggtgccaa attccagcgt aatattgaag agctgctggt agcgccggtt       300
     ccgactcatg tcattattgc cggatatgtc ggtggtggcg tggcgcgtgg tctgtttgtt       360
     ggtattttgg tgacggcaat ttcactgttt tttgtgccgt ttcaggtgca ttcgtgggta       420
     ttcgttgcct taaccctggt gctcactgcg gtgctattct cccttgcggg tttgctgaac       480
     ggcgtgtttg ccaaaacgtt cgatgacatc agcctggtgc caacctttgt gttaacgcca       540
     ctcacgtatt tgggcggggt gttttactcc ctgactttgt tgccgccgtt ctggcaaggg       600
     ctgtcgcacc tgaacccaat cgtttatatg atcagtggtt tccgctacgg cttcctcggt       660
     atcaatgatg ttccgctggt cactaccttt ggcgtactgg tggtctttat tgtggcgttt       720
     tatttgatct gttggtcgct gatccaacgt ggacgtggtt tgcgtagcta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page