(data stored in ACNUC7421 zone)

EMBL: FM180568.YADI

FM180568.YADI        Location/Qualifiers
FT   CDS_pept        150303..150743
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="E2348C_0132"
FT                   /product="predicted PTS Enzyme IIA"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07680"
FT                   /db_xref="GOA:B7UIH7"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIH7"
FT                   /protein_id="CAS07680.1"
FT                   /translation="MLGWVITCHDDRAQEILDALEKKHGALLQCRAVNFWRGLSSNMLS
FT                   RMMCDALHETDSGEGAIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACR
FT                   ETMTSSAFREHIVELGAPEVSSLWHQQQKNPPFVLKHNLYEY"
     atgttaggtt gggtaattac ctgtcacgat gaccgggcgc aagagatact ggatgcgctg        60
     gagaaaaaac atggggcact tcttcagtgc cgggccgtga atttctggcg cggattaagc       120
     tctaatatgc tcagccgcat gatgtgcgat gccttgcatg aaacggactc tggtgagggc       180
     gctatctttt taaccgatat agccggagcg ccaccgtacc gcgtggcttc attattaagc       240
     cacaaacact ctcgttgcga agtgatttct ggtgtcacgt taccgttaat tgaacagatg       300
     atggcttgcc gtgaaaccat gaccagttca gcgtttcgcg agcatattgt cgaactgggt       360
     gcgccggagg tgagtagtct ttggcaccaa caacaaaaaa atccgccttt cgtcctcaaa       420
     cataatttgt atgagtatta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page