(data stored in ACNUC7421 zone)

EMBL: FM180568.YADK

FM180568.YADK        Location/Qualifiers
FT   CDS_pept        complement(156830..157426)
FT                   /transl_table=11
FT                   /gene="yadK"
FT                   /locus_tag="E2348C_0139"
FT                   /product="predicted fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07687"
FT                   /db_xref="GOA:B7UII3"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B7UII3"
FT                   /protein_id="CAS07687.1"
FT                   /translation="MRPTQRNLMKKSILLLSLLFSTTFPVVAGQDVDIVANIKNNTYQS
FT                   GISNNGNIDLGVVGVGDFTGNISAENYHPGGKDFTITVQDCTLQGTGNVLNQLHINFRA
FT                   LSGVMATGSSQIFANEDNAGAKNVGVVIFSIQDPANTFNVLSATGSARSVYPVMSSALN
FT                   NSSWKFSTRMQKIDPALNVTSGPLISHVLVDIYYE"
     atgcgcccca ctcaacgtaa tctgatgaaa aaatcaattc tgcttctgtc gttgctattc        60
     agcaccactt tccctgtggt tgcaggacag gatgttgaca ttgttgcaaa tataaaaaat       120
     aacacctacc aaagtggcat cagcaacaac ggaaatattg atttaggtgt cgttggcgtg       180
     ggcgatttta ccggaaacat ttcagccgaa aattatcacc ccggtggaaa agatttcact       240
     attacagtac aagactgcac acttcagggc acagggaatg tgttaaatca gttacatatt       300
     aattttcgcg cacttagtgg cgtaatggcg acaggttcca gtcaaatatt cgctaatgaa       360
     gacaacgccg gggctaaaaa tgttggggta gttatatttt ctattcagga cccggcaaat       420
     accttcaacg ttcttagtgc cactggtagc gcacgttccg tttatccggt catgtcatca       480
     gcactaaata attcatcctg gaaatttagt acccgaatgc aaaaaatcga tccagcgctg       540
     aatgtcacct ctggcccact gataagccat gtgttagtgg atatctacta cgaataa          597
//

If you have problems or comments...

PBIL Back to PBIL home page