(data stored in ACNUC7421 zone)

EMBL: FM180568.YADN

FM180568.YADN        Location/Qualifiers
FT   CDS_pept        complement(162128..162718)
FT                   /transl_table=11
FT                   /gene="yadN"
FT                   /locus_tag="E2348C_0144"
FT                   /product="predicted fimbrial-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07692"
FT                   /db_xref="GOA:B7UII5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B7UII5"
FT                   /protein_id="CAS07692.1"
FT                   /translation="MSKKLGFALSGIMLAMAAGTTFAANDMDGGQLNISGLVVDNTCEA
FT                   RVDGGNKDGLILLQTATVAEITDGVLDTTVGAKAKPFSITIDCSKANPAPGTTAKMTFG
FT                   SVFFGNSKGTLNNDMSINTPSDGVNIALHNIEGSTIKQVQVNNPGDVYSKTLDSTSKSA
FT                   TYDFKASYVRADASRAATAGYVKTNSAYTITYQ"
     atgtctaaaa aattaggttt tgcgctgtcc ggtattatgt tggcaatggc tgctggtact        60
     acatttgctg ctaacgatat ggacggcggt caattaaata ttagcggtct ggtcgttgat       120
     aacacttgtg aagctcgtgt tgatggcggt aacaaagacg gtctgatcct gctgcaaacc       180
     gctactgttg ctgaaattac tgatggtgta ctggatacca ctgtaggcgc taaagctaaa       240
     ccattcagca ttactattga ctgcagcaaa gctaacccgg ctccgggtac tactgcaaaa       300
     atgaccttcg gttctgtttt ttttggtaac agcaaaggaa cactgaacaa cgacatgtct       360
     attaacaccc cgtctgacgg cgtaaatatc gctctgcaca atattgaagg ttctactatt       420
     aaacaggttc aggtcaataa tccgggtgat gtttacagca aaactctgga ttcaacgtct       480
     aaatctgcaa cctacgattt taaagcatcc tatgttcgtg cggatgcaag cagagcagct       540
     actgccggtt atgtaaaaac caactcagca tataccatta cttaccagta a                591
//

If you have problems or comments...

PBIL Back to PBIL home page