(data stored in ACNUC7421 zone)

EMBL: FM180568.YAEH

FM180568.YAEH        Location/Qualifiers
FT   CDS_pept        complement(194433..194819)
FT                   /transl_table=11
FT                   /gene="yaeH"
FT                   /locus_tag="E2348C_0170"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07718"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UIL0"
FT                   /protein_id="CAS07718.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDKGEFFAKS
FT                   VKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYIIDELDQICQRDRSEVDLKRKILDDL
FT                   RHLESVVTNKISEIEADLEKLTRK"
     atgtacgaca atctgaaaag tctgggtatt accaatcctg aagaaattga tcgttacagc        60
     ctccggcagg aagccaacaa cgatattctg aaaatctatt tccagaaaga caaaggcgag       120
     tttttcgcca agagcgtgaa gtttaaatac ccgcgtcagc gtaaaacggt cgtcgctgat       180
     ggtgtgggtc agggttataa agaagtccag gaaattagcc cgaatctacg gtatatcatt       240
     gatgagcttg atcaaatctg ccagcgtgac cgcagcgaag ttgatcttaa gcgtaagatc       300
     ctcgacgact tacgtcacct ggagtcagta gtaaccaata agatcagcga gattgaagcc       360
     gatctggaaa aactgacgcg taaataa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page