(data stored in ACNUC7421 zone)

EMBL: FM180568.YAEJ

FM180568.YAEJ        Location/Qualifiers
FT   CDS_pept        224834..225256
FT                   /transl_table=11
FT                   /gene="yaeJ"
FT                   /locus_tag="E2348C_0197"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07745"
FT                   /db_xref="GOA:B7UJ93"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJ93"
FT                   /protein_id="CAS07745.1"
FT                   /translation="MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRA
FT                   SSLPEYYKERLLAASHHLISSDGVIVIKAQEYRNQELNREAALARLVAVIKDLTTEQKA
FT                   RRPTRPTRASKERRLASKAQKSSVKAMRGKVRSGRE"
     atgattgtga tttcccgaca tgttgctatc cccgatggtg agcttgagat caccgccatt        60
     cgtgcgcagg gcgcgggcgg gcagcatgtt aataagacct caacggctat tcatctgcgt       120
     tttgacattc gggcgtccag cctgccagag tattacaaag agcgtctgct cgccgccagc       180
     catcacttga tcagcagtga tggggtgatt gtcattaagg cacaggaata ccgcaatcag       240
     gagctcaacc gcgaagcggc gctggcccgg ctggtggcag tgattaaaga tttaacaaca       300
     gaacaaaaag cccgacgacc cacgcggccc acccgcgcat caaaagagcg caggctggca       360
     tcgaaagcac aaaaatcaag cgtgaaggcg atgcgcggca aagtgcgcag cggtcgggaa       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page