(data stored in ACNUC7421 zone)

EMBL: FM180568.YAFD

FM180568.YAFD        Location/Qualifiers
FT   CDS_pept        241081..241881
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="E2348C_0209"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07757"
FT                   /db_xref="GOA:B7UJA5"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJA5"
FT                   /protein_id="CAS07757.1"
FT                   /translation="MRKNTYAMRYVAGQPAERILPPGSFASIGQALPPGEPLSTEERIR
FT                   ILVWNIYKQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFVLP
FT                   QHPSGVMTLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNIHAVNFSLG
FT                   VDVYSKQLLPIGDQIAHHSGPVIMAGDFNAWSRRRMNALYRFAREMSLRQVRFTDDQRR
FT                   RAFGRPLDFVFYRGLNVSEASVLVTRASDHNPLLVEFSPGKPDK"
     gtgcgaaaaa acacctatgc catgcgctat gttgccggac aacctgcgga aaggatctta        60
     ccgccggggt cttttgcgag catcggccag gcattaccac ctggagaacc gttaagtacc       120
     gaagagcgta ttcggatcct ggtgtggaac atatacaaac agcaacgcgc tgaatggttg       180
     tcggtattaa agaactacgg caaagatgca catctggtgt tattgcagga agcgcagaca       240
     acgccagagt tagtacagtt tgcgaccgct aactatcttg ccgccgatca ggtacccgct       300
     ttcgtgctgc cacaacatcc ttctggcgta atgacccttt cggcggcaca tccagtgtat       360
     tgctgcccgt tacgtgaacg agaacccatt ttgcgtctgg cgaagtcggc actggtgacg       420
     gtctatccgt tacctgacac ccgcctgttg atggtggtta atatacacgc cgtcaacttc       480
     agtctgggcg tggatgtcta tagtaagcag ttacttccta ttggcgatca gatagctcac       540
     cacagtggcc cggtcattat ggcgggagat ttcaatgcct ggagccgtag aaggatgaac       600
     gcgttatatc gctttgcgcg ggaaatgtcg ctgcgccagg tgcgttttac cgatgatcag       660
     cgccgtcggg cgtttggtcg cccgctcgat tttgttttct accgtggtct gaacgtcagc       720
     gaagcttctg tactggttac gcgcgcgtcc gatcacaatc cgctactcgt tgaattcagt       780
     cccggcaagc ctgataaata a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page