(data stored in ACNUC7421 zone)

EMBL: FM180568.YAFP

FM180568.YAFP        Location/Qualifiers
FT   CDS_pept        259114..259566
FT                   /transl_table=11
FT                   /gene="yafP"
FT                   /locus_tag="E2348C_0227"
FT                   /product="predicted acyltransferase with
FT                   acyl-CoAN-acyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07775"
FT                   /db_xref="GOA:B7UJC2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJC2"
FT                   /protein_id="CAS07775.1"
FT                   /translation="MNNIQIRNYQPGDFQQLCAIFIRAVTMTASQHYSPQQIAAWAQID
FT                   ESRWKEKLAKSQVRVAVINAQPVGFISRIEHYIDMLFVDPEYTLRGVASALLKPLIKSE
FT                   SELTVDASITAKPFFERYGFQTVKQQRVECRGAWFTNFYMRYKPQH"
     atgaataaca tacaaataag aaactatcag cctggcgatt ttcagcaact atgcgctatt        60
     ttcattagag cggttacgat gaccgccagt cagcattatt caccacaaca aattgccgcc       120
     tgggcgcaga ttgacgaatc tcgctggaag gagaaactcg cgaaatcaca agtgcgggtt       180
     gcagttatta atgcacaacc ggttggtttt atctcccgca ttgaacatta tatcgatatg       240
     ttatttgttg accctgaata caccctccgt ggggttgcca gcgctttgtt aaaacctttg       300
     attaagtctg aatccgaact tacggtggac gccagcataa ccgcaaaacc cttttttgaa       360
     cgttatggtt ttcagacagt taagcagcag cgcgttgaat gccggggagc gtggtttact       420
     aatttttata tgcgatataa accgcaacat taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page