(data stored in ACNUC7421 zone)

EMBL: FM180568.YAHC

FM180568.YAHC        Location/Qualifiers
FT   CDS_pept        complement(314171..314668)
FT                   /transl_table=11
FT                   /gene="yahC"
FT                   /locus_tag="E2348C_0279"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07827"
FT                   /db_xref="GOA:B7UJH0"
FT                   /db_xref="InterPro:IPR009476"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJH0"
FT                   /protein_id="CAS07827.1"
FT                   /translation="MNGLTATGVTVGICAGLWQLVSSHVGLSQGWELLGTIGFVAFCSF
FT                   YAAGGGKSGFIRSLAVNYSGMVWAFFAALAAGWLAPVSGISGVWASVITTVPFSAVVVW
FT                   QGRFWLLSFIPGGFLGMTLFFASGMNWTVTLLGFLAGNCVGIISEYGGQKLSEATTKRD
FT                   GY"
     atgaacggac tcacggcaac gggtgtcacc gtcggtattt gtgcagggct ttggcagtta        60
     gtgtcttcac atgtcgggct ctctcaggga tgggaattat taggaaccat tggcttcgtc       120
     gccttttgca gtttttatgc cgcaggcggc ggtaaatcgg ggtttatcag aagcctagcg       180
     gttaattatt ccgggatggt gtgggcgttt ttcgccgcgc tggctgccgg ttggctggcc       240
     ccggtgagtg ggatttccgg ggtctgggcg agcgtaatta cgactgtacc cttctcggcg       300
     gtggtggtct ggcaagggcg tttctggtta ctgtctttta ttcccggggg ctttctcggc       360
     atgacgctat tttttgccag cgggatgaac tggacggtga cattactggg ttttctggcg       420
     ggtaactgcg tggggataat ttcagaatat ggcggacaaa aattaagcga agcgacgact       480
     aaacgcgacg ggtattaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page