(data stored in ACNUC7421 zone)

EMBL: FM180568.YAHF

FM180568.YAHF        Location/Qualifiers
FT   CDS_pept        316424..317971
FT                   /transl_table=11
FT                   /gene="yahF"
FT                   /locus_tag="E2348C_0282"
FT                   /product="predicted acyl-CoA synthetase with NAD(P)-binding
FT                   domain and succinyl-CoA synthetase domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07830"
FT                   /db_xref="GOA:B7UJH3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJH3"
FT                   /protein_id="CAS07830.1"
FT                   /translation="MSVKIVIKPNTYFDSVSLMSISTRANKLDGVEQAFVAMATEMNKG
FT                   VLKNLGLLTPELEQAKNGDLMIVINGKSGVDNEQLLAEIEELFNTKAQSGSHEARYATI
FT                   ASAKKHIPESNLAVISVNGLFAAREARQALQNDLNVMLFSDNVSVEDELALKQLAHEKG
FT                   LLMMGPDCGTAIINGTALCFGNAVRRGNIGIVGASGTGSQELSVRIYEFGGGVSQLIGT
FT                   GGRDLSEKIGGLMMLDAIGMLENDPQTEIIVLISKPPAPAVARKVLERARACRKPVVAC
FT                   FLGRGETPVDEQGLQFARGSKEAALKAVMLSGVKQEHLDLHTLNQPLIADVRARLQSQQ
FT                   KYIRGLFCGGTLCDETLFAVMEKHGDVYSNIQPDPEFRLQDINRSIKHTFLDFGDDDFT
FT                   NGKPHPMIDPTNRISRLIEEARDPEVAVIVMDFVLGFGSHEDPVGSTIEAIKEAKAIAA
FT                   AEGRELIILAYVLGTDLDTPSLEQQSQMLLDAGVILASSSTNTGLLAREFICKGEEA"
     atgtcagtta aaatagtcat taaaccgaat acctattttg attctgtctc gctgatgtct        60
     atctccacgc gtgcaaataa actcgacggc gtcgagcagg catttgtggc gatggcgacc       120
     gaaatgaaca aaggcgtgtt gaagaattta ggactgctga cgccggagct ggagcaagcg       180
     aaaaacggcg acctgatgat tgtcatcaat ggtaaatcgg gtgtggacaa cgagcagttg       240
     ctggcggaga ttgaagaact gttcaacacc aaagcgcaaa gcggctcgca cgaggcgcgt       300
     tacgccacta ttgccagcgc caaaaagcat atcccggaaa gtaacctggc agtgatttcg       360
     gtcaacggtc tgtttgccgc tcgcgaagcg cgtcaggcgc tgcaaaatga cctcaacgtg       420
     atgctgtttt ccgataatgt ctcagttgaa gatgaactgg cgctcaaaca gttggcccat       480
     gaaaaagggc tgctgatgat ggggccagac tgcggcacgg cgattatcaa cggcacggcg       540
     ctctgctttg gtaacgccgt gcgtcgcggc aacatcggta ttgttggcgc atctggcacc       600
     ggcagccagg aattgagcgt ccgtatctat gaatttggtg gcggcgtttc acaactgatc       660
     ggcaccggcg ggcgcgacct gagcgagaaa atcggtggcc tgatgatgct cgatgccatc       720
     gggatgctgg aaaacgatcc gcaaactgaa atcattgtgc ttatctccaa accgcctgcg       780
     cctgcggtgg cccgcaaagt gctggaacgc gcacgcgcct gccgcaagcc agtggtggcc       840
     tgcttcctcg gtcgtggcga aacgccagtg gatgagcagg ggctacagtt tgctcgcggc       900
     agcaaagagg cggcattgaa agcggtgatg ctctccggcg tgaaacaaga acatctcgac       960
     ctgcatacgc ttaaccagcc gttgattgcg gatgtgcgtg cgcgtctgca atcgcagcag      1020
     aaatacattc gtggtctgtt ctgcggcggt acgctgtgtg acgaaaccct gttcgcggtg      1080
     atggaaaaac atggcgatgt ctacagcaat atccagcccg atcctgaatt ccgcctgcaa      1140
     gatatcaacc gcagcatcaa acacaccttc ctcgattttg gcgatgatga cttcaccaac      1200
     ggcaagccgc atccaatgat tgacccgacc aaccgtatca gccgcttgat cgaagaagcg      1260
     cgcgatccag aagtggcggt gatcgtgatg gattttgtgc tcggatttgg atcgcatgaa      1320
     gatccggtcg gttccaccat cgaggcgatc aaagaagcga aagcgatcgc cgctgccgaa      1380
     ggacgcgagt tgatcattct cgcctatgtg ctgggcaccg atctcgatac gccatcatta      1440
     gaacaacaaa gccagatgct gcttgatgcc ggagtgattc tggcgagcag cagcaccaat      1500
     accggattgc tggcgcgtga atttatctgc aaaggggagg aagcctga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page