(data stored in ACNUC7421 zone)

EMBL: FM180568.YAHG

FM180568.YAHG        Location/Qualifiers
FT   CDS_pept        317971..319389
FT                   /transl_table=11
FT                   /gene="yahG"
FT                   /locus_tag="E2348C_0283"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07831"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJH4"
FT                   /protein_id="CAS07831.1"
FT                   /translation="MSQSLFSQPLNVINVGIAMFSDDLKKQHVEVTQLDWTPPGQGNMQ
FT                   VVQALDNIADSPLADKITAANQQALERIIQSHPVLIGFDQAINVVPGMTPKTILHAGPP
FT                   VTWEKMCGAMKGAVTGALVFEGLAKDLDEAAELAASGEITFSPCHEHDCVGSMAGVTSA
FT                   SMFMHIVKNKTYGNVAYTNMSEQMAKILRMGANDQSVIDRLNWMRDVQGPMLRDAMKII
FT                   GEIDLRLMLAQALHMGDECHNRNNAGTTLLIQALTPGIIQAGYSVEQQREVFEFVASSD
FT                   YFSGPTWMAMCKAAMDAAHGIEYSTVVTTMARNGVEFGLRVSGLPGQWFTGPAQQVIGP
FT                   MFAGYKPEDSGLDIGDSAITETYGIGGFAMATAPAIVALVGGTVEEAIDFSRQMREITL
FT                   SENPNVTIPLLGFMGVPSAIDITRVGSSGILPVINTAIAHKDAGVGMIGAGIVHPPFAC
FT                   FEKAILGWCERYGV"
     atgagccagt cactgtttag ccaaccgttg aacgttatta acgtcggtat cgccatgttt        60
     agcgatgatc tgaaaaagca gcatgtagaa gtgacccaac tcgactggac gccgccgggg       120
     cagggcaata tgcaggtggt gcaggcactg gacaacattg ccgattcgcc gctggcggac       180
     aaaatcaccg ccgctaacca gcaggcgctg gagcgcatta tccagtcgca tccggtgctg       240
     attggttttg atcaggcgat taacgtggtg ccgggcatga cgccgaaaac cattcttcac       300
     gccgggccgc cggtcacctg ggaaaaaatg tgcggcgcga tgaaaggcgc ggtcaccgga       360
     gcgctggtgt ttgaaggact ggcgaaagat ctcgacgagg cggctgagct ggcggcttcc       420
     ggggagatca ccttctcgcc gtgccacgag cacgactgtg tgggatcgat ggcgggcgtc       480
     acctcggcct cgatgtttat gcacatcgtg aaaaacaaaa cctatggcaa cgtcgcttat       540
     accaacatga gcgagcagat ggcgaagatt ttgcgtatgg gcgctaacga ccagagcgtg       600
     atcgaccgcc tcaactggat gcgcgatgtg cagggaccca tgctgcgcga cgcgatgaaa       660
     attatcggcg aaatcgatct gcgcttaatg ctggcgcagg cgctgcatat gggcgatgaa       720
     tgccataacc gcaataacgc cgggacgacg ctgctgattc aggcgctgac gccggggatt       780
     attcaggcag gttattccgt cgagcaacag cgcgaagtgt ttgagtttgt cgccagcagc       840
     gactacttct ccggcccgac gtggatggcg atgtgtaaag cggcgatgga tgcggcgcac       900
     ggcatcgaat acagcaccgt ggtgaccacc atggcgcgta acggcgtcga gttcggcctg       960
     cgggtcagcg gcctgccggg gcagtggttt accggcccgg cgcagcaggt catcggcccg      1020
     atgtttgccg gttataagcc ggaagattca gggctggata ttggcgacag cgccatcacc      1080
     gaaacctacg gtatcggcgg atttgcgatg gcgaccgcgc ccgcgatcgt cgcgctggtg      1140
     ggtggcacgg tggaagaggc tatcgatttc tcccgtcaga tgcgtgaaat cacccttagc      1200
     gaaaacccca acgtcaccat tccgctgctc ggttttatgg gcgttccgtc ggcaatcgac      1260
     atcacccgcg tgggtagcag cggcattctg ccagtgatca acaccgccat cgcccataaa      1320
     gatgcgggcg tcggcatgat tggcgcgggc attgtgcatc cacccttcgc ctgcttcgag      1380
     aaagccattc tcggctggtg cgaacgttac ggcgtctga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page