(data stored in ACNUC7421 zone)

EMBL: FM180568.YAHI

FM180568.YAHI        Location/Qualifiers
FT   CDS_pept        319719..320669
FT                   /transl_table=11
FT                   /gene="yahI"
FT                   /locus_tag="E2348C_0285"
FT                   /product="predicted carbamate kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07833"
FT                   /db_xref="GOA:B7UJH6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJH6"
FT                   /protein_id="CAS07833.1"
FT                   /translation="MKELVVVAIGGNSIIKDNASQSIEHQAEAVKAVADTVLEMLASDY
FT                   DIVLTHGNGPQVGLDLRRAEIAHEREGLPLTPLANCVADTQGGIGYLIQQALNNRLARH
FT                   GEKKAVTVVTQVEVDKNDPGFAHPTKPIGEFFSESQRDELQKANPDWRFVEDAGRGYRR
FT                   VVASPEPKRIVEAPAIKALIQQGFVVIGAGGGGIPVVRTDAGDYQSVDAVIDKDLSTAL
FT                   LAREIHADILVITTGVEKVCIHFGKPQQQALDRVDIATMTRYMQEGHFPPGSMLPKIIA
FT                   SLTFLEQGGKEVIITTPECLPAALRGETGTHIIKT"
     atgaaagaac ttgtggtcgt tgccattggt ggcaacagca ttatcaaaga taacgccagc        60
     cagtcgattg agcatcaggc ggaggcggtg aaagccgtgg ccgatacggt gctggaaatg       120
     ctggcttccg attacgacat tgtgctgacc cacggcaacg ggccgcaggt cgggctggat       180
     ttacgccgcg cggagattgc ccacgagcgc gaagggctgc ccttaacgcc gctagcgaac       240
     tgtgtggcgg atacgcaagg tggcattggc tatctgatcc agcaggcgct gaacaaccga       300
     ctggcgcgtc acggcgagaa aaaagccgtc accgtggtga ctcaggtgga agtggataaa       360
     aacgatccgg ggtttgccca tcccaccaag cccatcggcg aattctttag tgaaagccag       420
     cgtgacgaac tacaaaaggc aaaccctgac tggcgttttg ttgaagatgc cggacggggc       480
     tatcgccgcg tggtcgcctc gccggaaccg aaacgtattg tcgaagcacc agccattaag       540
     gcgctgatcc aacaaggctt tgtggtgatt ggcgcgggcg gcggcggaat tccggtagtg       600
     cgtactgacg cgggggatta ccaaagcgtg gacgcggtta tcgacaaaga tctctctacc       660
     gcgctactgg ctcgcgaaat tcacgccgac attctggtga tcaccactgg cgtcgaaaaa       720
     gtgtgtattc actttggcaa accgcagcag caggcgctgg atcgcgtaga tattgccacc       780
     atgacccgct atatgcagga agggcatttc ccacctggca gcatgttgcc aaaaatcatc       840
     gccagcctga cgttcctgga acagggcggc aaagaagtga ttatcaccac gccggaatgc       900
     ctgcctgcgg cgctacgcgg cgaaacgggc acccatatta ttaaaaccta a                951
//

If you have problems or comments...

PBIL Back to PBIL home page